Recombinant Schizosaccharomyces pombe Protein transport protein yos1(yos1)

Code CSB-CF521048SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O13825
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MFGFGNILYVTLLLLNAVAILSEDRFLGRIGWSQSAALGFGDRQDTIKSRILHLIRAIRT VMTFPLIAINTIVIVYNLVLG
Source in vitro E.coli expression system
Gene Names yos1
Protein Names Recommended name: Protein transport protein yos1
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for protein transport between endoplasmic reticulum and Golgi apparatus.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein
Protein Families YOS1 family
Database Links

KEGG: spo:SPAC19A8.09

STRING: 4896.SPAC19A8.09.1

Related Products

yos1 Antibodies

yos1 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

yos1 Proteins

yos1 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.