Recombinant Schizosaccharomyces pombe Sterol regulatory element-binding protein 1 (sre1)

Code CSB-CF892573SXV
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
sre1
Uniprot No.
Alternative Names
sre1; SPBC19C2.09; Sterol regulatory element-binding protein 1
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Expression Region
1-407
Target Protein Sequence
MQSSIPSVSVSVASPAMETPTKASPDSKSPNSVGAIPSSSPLASSTKASTSTPFVENCSN LLCDLASIVEDSPPTLTNTSLSPHSFSLSDMESSMSNWLNPFAFDNTMNSAPPLFTSTNM GSPNSLENSTNPLLSNCGSPNSFQNETFTGPSLNEFDADDKIQRQMKILHSVDTIDPSTV QNYPSADMSNPEVKLKTEEIITPMDTTCKPEPSAKKIKLSPSSEDSCSIPETLPFSAPKS RGSLSPSETPDFVAGPGGKPKKTAHNMIEKRYRTNLNDRICELRDAVPSLRAAAALRCGN SLDDEDLGGLTPARKLNKGTILAKATEYIRHLEAKNKELQKTNKQLSDRLAFYEDPSMAP PSNDTRAVNSVNVVSSSDYSVHQSSRPNLTQRAFTSPTLNTMGRTAL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane. Low oxygen or sterol conditions promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes required for adaptation to anaerobic growth.; Transcriptional activator required for transcription of genes required for adaptation to anaerobic growth like those implicated in the nonrespiratory oxygen-consumptive biosynthetic pathways of sterol, heme, sphingolipid, and ubiquinone biosynthesis. May monitor oxygen levels through sterol synthesis steps which require oxygen.
Gene References into Functions
  1. Sre1 and Mga2 are each regulated by the lipid product of the other transcription factor pathway, providing a source of coordination for these two branches of lipid synthesis PMID: 28202541
  2. Here we report the in vitro reconstitution of the complex between the C domains of Sre1 and Scp1 as well as the crystal structure of the WD40 domain of Scp1 at 2.1 A resolution. PMID: 25771684
  3. We describe our isolation and characterization of the casein kinase 1 family member Hhp2 as a novel regulator of Sre1N. PMID: 24327658
  4. Data indicate that when oxygen is present, the prolyl hydroxylase Ofd1 down-regulates sterol regulatory element-binding protein Sre1N activity in two ways: first, by inhibiting its binding to DNA, and second, by accelerating its degradation. PMID: 22833559
  5. Sre1p is a principal activator of anaerobic gene expression, upregulating genes required for nonrespiratory oxygen consumption. PMID: 16537923
  6. Ofd1 dioxygenase domain functions as an oxygen sensor that regulates binding of Nro1 to Ofd1 to control oxygen-dependent Sre1N stability. PMID: 19158663
  7. Degradation of Sre1 in the absence of Scp1 requires the ER-associated degradation (ERAD) components Ubc7, an E2 ubiquitin conjugating enzyme, and Hrd1, an E3 ubiquitin ligase. PMID: 19520858

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1