Recombinant Schizosaccharomyces pombe UDP-galactose transporter(gms1)

Code CSB-CF310427SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P87041
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MAVKGDDVKWKGIPMKYIALVLLTVQNSALILTLNYSRIMPGYDDKRYFTSTAVLLNELI KLVVCFSVGYHQFRKNVGKEAKLRAFLPQIFGGDSWKLAIPAFLYTCQNNLQYVAAGNLT AASFQVTYQLKILTTAIFSILLLHRRLGPMKWFSLFLLTGGIAIVQLQNLNSDDQMSAGP MNPVTGFSAVLVACLISGLAGVYFEKVLKDTNPSLWVRNVQLSFFSLFPCLFTILMKDYH NIAENGFFFGYNSIVWLAILLQAGGGIIVALCVAFADNIMKNFSTSISIIISSLASVYLM DFKISLTFLIGVMLVIAATFLYTKPESKPSPSRGTYIPMTTQDAAAKDVDHKH
Source in vitro E.coli expression system
Gene Names gms1
Protein Names Recommended name: UDP-galactose transporter Alternative name(s): Golgi UDP-Gal transporter
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Essential for the transport of UDP-galactose into the lumen of Golgi apparatus.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein
Protein Families Nucleotide-sugar transporter family, SLC35A subfamily
Database Links

KEGG: spo:SPCC1795.03

STRING: 4896.SPCC1795.03.1

Related Products

gms1 Antibodies

gms1 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

gms1 Proteins

gms1 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.