Recombinant Schizosaccharomyces pombe UPF0347 membrane protein C1711.03(SPBC1711.03)

Code CSB-CF889226SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9P787
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MQKLLLDPALRNWVLLPIMFVMILIGILRHNATILLQSSPKKLSKEEIREQRLLQRAYAL RACSNSLLPESIEARKCFLIESLKSGKYLKPVDPNAPKAANPLMDDKTLEGLMESMKGNM LMVVPQTIIMTWINEFFSGFILLKLPFPLTLRFKSIFQSGVATQDLDVQWVSSISWYFLN LFGLKSVYALLLGENNAASNATNEMGMAGFSSAAATAQLIQPGQDISKMMLSEAENVQIL KNESLLVDVEKRLLAQFA
Source in vitro E.coli expression system
Gene Names SPBC1711.03
Protein Names Recommended name: UPF0347 membrane protein C1711.03
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cytoplasm, Membrane, Multi-pass membrane protein
Protein Families EMC3 family
Database Links

KEGG: spo:SPBC1711.03

STRING: 4896.SPBC1711.03.1

Related Products

SPBC1711.03 Antibodies

SPBC1711.03 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

SPBC1711.03 Proteins

SPBC1711.03 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.