Recombinant Schizosaccharomyces pombe Uncharacterized RING finger protein C947.10 (SPBC947.10)

Code CSB-CF523679SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O43085
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MLFAPAPRLPSRNGESSEKSIKAEKRAFSEIKNATFLNIPERVEHSLTFPTEIWETRDGL FEEPVGKGDSHLNHTSVMTGNWNILPYPSFGKVSPNVTWHTTLRNIVMSQSGRFSANLYE YVDGNSDGISFVLNLENNNDTSVYHMTFHGDRVKPINVFLGSTDVTPNFGGVDVIPWLLK DSPYKDAPPLDGTEYFPLLQNRSLERIETRLQDAQTVGWSPLVFEEEEVTCSAFVFLHNK NTGLDKETLKAIENEFYHPQGVSTQKMPEVFVSGLVYSPDCNVAFTFSNTKGPRNFVLEN HLVRFSSLYIFIVLSQIFVLLRQMRINSPSHVQRLSFLTIAMQAGLDAYIAIFFLSTNAV IEKGYLPFVSVAFLSLVPSVMFTMRYLALILRVQNSNMPPPAPRPVTNNSSNNNTNQSNA SNENSPNAPSAANDNTETTTVNPPQEDDQPMTQHERDQRDWSAVCLRFYFIILVVCIASL YSAFWPVIYRFYFISALIFTSYSFWIPQIIQNVKQGTSRSFTWTYILGASVLRLYLPLAI FIDSELILGFPPKYFFALGLVLWMLFQVLVLLVQDTLGPRFFLPKKFFLSSPVYDYHPVI QQDDLEAFMRDANVCPICMQPIELVSTGSTLNPASMMVRRNYMLTPCHHLYHRQCLLQWM ETRSICPVCRCHLPAV
Source in vitro E.coli expression system
Gene Names dsc1
Protein Names Recommended name: Uncharacterized RING finger protein C947.10
Expression Region 1-676
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalytic component of the DSC E3 ubiquitin ligase complex which is required for the sre1 transcriptional activator proteolytic cleavage to release the soluble transcription factor from the membrane in low oxygen or sterol conditions. The complex plays also an important role in the multivesicular body (MVB) pathway and functions in a post-endoplasmic reticulum pathway for protein degradation.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein
Database Links

KEGG: spo:SPBC947.10

STRING: 4896.SPBC947.10.1

Related Products

dsc1 Antibodies

dsc1 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

dsc1 Proteins

dsc1 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.