Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C12B10.09(SPAC12B10.09)

Code CSB-CF611969SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q10442
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MIFNYVFSNSFSFLYLMVNVQCRIKEIMYWNICLYWDVFSKLIIYNKVCQFGRIHIFHGK NRHQLLRTCHFTPSKRHSAMSFFEALGAGICAGLAVDLSLFPIDTLKTRLQAKGGFVKNG GFHGVYRGLGSILVGSAPGASLFFTTYENMKSRLSQSGLGLSDPQIHMCSASLGEIAACI VRVPTEVIKQRAQASGGTLSSRNILQTILKSNNVWRDFYAGYGITIAREIPFTLIQFPIW EHLKLKWRIKHSRNKNLAHEAAISGSIAGGIAAALTTPFDVVKTRIMTSQQRLSYVFTIK SIVAHEGFLALYKGIVPRVLWLSGGGAIFLGCYDVILNFMKAEGL
Source in vitro E.coli expression system
Gene Names SPAC12B10.09
Protein Names Recommended name: Uncharacterized mitochondrial carrier C12B10.09
Expression Region 1-345
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family
Database Links

KEGG: spo:SPAC12B10.09

STRING: 4896.SPAC12B10.09.1

Related Products

SPAC12B10.09 Antibodies

SPAC12B10.09 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

SPAC12B10.09 Proteins

SPAC12B10.09 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.