Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.03c(SPCC191.03c)

Code CSB-CF896956SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9Y7P7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MRSNNSSLVHCCWVSPPSLTRLPAFPSPRILSPCYCYNKRIRPFRGLTSYRQASYSLGFP LGLLVFLHSLIVARFFVASKSRSCIVRSLLFWINLDSADSRISVLFQCFFCIDIWTV
Source in vitro E.coli expression system
Gene Names SPCC191.03c
Protein Names Recommended name: Uncharacterized protein C191.03c
Expression Region 1-117
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

KEGG: spo:SPCC191.03c

Related Products

SPCC191.03c Antibodies

SPCC191.03c Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

SPCC191.03c Proteins

SPCC191.03c Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.