Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf14(wtf14)

Code CSB-CF525587SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O74512
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MENNHHLAKDSLDELNPKRGKGEHETQVSQYTVVEEATIPQSLVKTSRPADHKVMEASKV ADTRTAWSTKIPAVLLPVFVINIALFKYLVFANFSTKDRVLFGLGNGGINIFSMWLLLAT YETWFRSIKEVIVACGAGIRSFPQKRGVNMLYAILKLTFVNAFAIPLLMFFRSHFEQWRL GCPLVERVIGVMLNVAYFIIEIGSFFKILINANFTRKSWFIH
Source in vitro E.coli expression system
Gene Names wtf14
Protein Names Recommended name: Uncharacterized protein wtf14
Expression Region 1-222
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families WTF family
Database Links

KEGG: spo:SPCC663.02

STRING: 4896.SPCC663.02.1

Related Products

wtf14 Antibodies

wtf14 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

wtf14 Proteins

wtf14 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.