Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf21(wtf21)

Code CSB-CF526716SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O74474
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MKNNYTSLKSPLDEEDELKTDHEIDLEKGPLPEYDSEEEGALPPYSDHALVNNPPNTHRE NNPSRSTDNSSPFLIKLLISFTPIYVLNVLAICYLTYKDAFFKDYGAAEWTLFGFWCLVC TLALIFLTYFYETWVKAVKVTVISLAKCVKVISIGLFNIRREMMIIIWILWLIICCILFV YIKSGDLILNKALICSTCTISAVLLLIVSSVCIPFWTFERTLAKLAKVLLLQSGIVLVLN GTMFLRGKHFERIGCEIEASVLFIMGNVLFLCEMECPGALIRTRNSIRNGIAFILGGIGN AMMGLANAIRGANDNNDIPLGEMDVESEV
Source in vitro E.coli expression system
Gene Names wtf21
Protein Names Recommended name: Uncharacterized protein wtf21
Expression Region 1-329
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families WTF family
Database Links

KEGG: spo:SPCC1739.15

STRING: 4896.SPCC1739.15.1

Related Products

wtf21 Antibodies

wtf21 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

wtf21 Proteins

wtf21 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.