Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf5(wtf5)

Code CSB-CF837455SXV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8TF80
Storage Buffer Tris-based buffer,50% glycerol
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Sequence MKNNYTSLKSPLDEEDELKTDHEIDLEKGPLPEYDSEEESTLPPYSDHALVNNPPNTHRE NHSYGTTDNSSPLLIILLISFTSIILFNAPEVCYLKYKDAFFKNYGAAEWTLFGFWCLVC TLALIFLTYFYETWTKAVKVTVISLAKCVKVTAIFLAQCVKACGKGIKHFLKKWENMPMA FSEVFLFNILVGSPRMNLRYIFGDRWGLKCSLADHIIFVVLSILVFIAETVKPGSIRVNL IRKMGYEAKQQVNEYTAVPLREMNSESEA
Source in vitro E.coli expression system
Gene Names wtf5
Protein Names Recommended name: Uncharacterized protein wtf5
Expression Region 1-269
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families WTF family
Database Links

KEGG: spo:SPCC794.02

Related Products

wtf5 Antibodies

wtf5 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

wtf5 Proteins

wtf5 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.