Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF810970FMR |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q8DVB6 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Streptococcus mutans serotype c (strain ATCC 700610 / UA159) |
| Sequence | MLMILLFQRLGIIMILAFLLVNNSYFRQLIEERSKREKLVLIIIFGIFVIISNMTGIEIT SDKSLVERPILTTISHSDSLANTRTLVITTASLVGGPLVGTVVGFIGGVHRFFQGNFSGA FYIVSSALVGYISGRLGDQLKTNNLYPSTSQVIVISIIAESIQMLFVGFFTGWDLVKLIF IPMMLLNSLGSTLFLAILKTYLSNERQLRAVQTRDVLDLTQQTLPYLRQGLSQQSATKVC NIIKQHTNFDAVGLTDRTNVLAHIGVGQDHHIAGQAVKTDLSKSVILNGQPQIALDKTAI ACPDQSCLLNSAIVVPLKINNETVGALKMYFSGDKKMTEVEENLALGLAQIFSGQLAIGI AEEQNKLANIAEIKALQSQINPHFFFNAINTISALIRLDANKARYALMQLSTFFRTSLQG GQDREISLEQEKAHVDAYMNLEKLRFPDKYQLDYHITVSTKMTLPPFGLQVLVENAVRHA FKERKKDNHICISITDQGEFYKVAVSDNGQGISPNMIDKLGQETVSESKGTGTALVNLNN RLNLLYGSASQLHFDSTDQGTTVWYEIPYQKGDKDEHFNS |
| Source | in vitro E.coli expression system |
| Gene Names | lytS |
| Protein Names | Recommended name: Sensor protein lytS EC= 2.7.13.3 |
| Expression Region | 1-580 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Member of the two-component regulatory system LytR/LytS that probably regulates genes involved in cell wall metabolism. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Database Links |
KEGG: smu:SMU_577 STRING: 210007.SMU_577 |
lytS Proteins for Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP810970FMR1 CSB-EP810970FMR1 CSB-BP810970FMR1 CSB-MP810970FMR1 |
Recombinant Sensor protein lytS(lytS) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Immunoglobulin iota chain(VPREB1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Plasminogen activator inhibitor 1(Serpine1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Annexin A8-like protein 2(ANXA8L2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Non-histone chromosomal protein HMG-17(HMGN2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Breast carcinoma-amplified sequence 1(BCAS1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Molybdopterin synthase catalytic subunit(MOCS2)
Express system: E.coli
Species: Homo sapiens (Human)
