Recombinant Serpentine receptor class alpha-12(sra-12)

Code CSB-CF637375CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q20410
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Caenorhabditis elegans
Sequence MGCASEIQAEIFTSFGQLFYASFQTILFLATIIGSLLAIFELCKKTTVPDSTRVLLIGSL FFANAHEFAYFTAPLKVFQLNIFNTNTSCYPLISTRDCIPTTTVLAMGISGNMLIQSALS IDRLLATIFPFSYSRMRALPGFVLLIMVLIPAMFTYSWIRLDIVLDDYQMFCSQWSANIS TRANTFLEICSYLTVAHIIINCLIILRNRAIEKRCRFDVTQRYLTSENLKTTQAICYLSI AQFLAMFMYSGGVLLMRKNRENIPTLIYFNVIVWVYAPPYACVSLAPLILFSLWNLKKQR HIQIKSVQSAQKETQDDYIRKLQKSWK
Source in vitro E.coli expression system
Gene Names sra-12
Protein Names Recommended name: Serpentine receptor class alpha-12 Short name= Protein sra-12
Expression Region 1-327
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Nematode receptor-like protein sra family
Tissue Specificity Expressed in neurons RIF/RIG and PVT.
Database Links

KEGG: cel:CELE_F44F4.7

STRING: 6239.F44F4.7

UniGene: Cel.18259

Related Products

sra-12 Antibodies

sra-12 Antibodies for Caenorhabditis elegans

sra-12 Proteins

sra-12 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.