Recombinant Serpentine receptor class beta-2(srb-2)

Code CSB-CF850210CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q95ZY1
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MNHIQILEYENECQLANEVTYHPVYRIAQLWTFVVSILAIPALYIFLMKRILPLPFHGNI KFLLVCYFSASFVFAVLLAFLFSYHVVAPLFITSMCDLIIRPSLYKVGNLSLTLFMTIQM IMPLGFSIERFIALSMTKSYENVRTFLGPLLVFTLIGIDLALLYHVFRDEKFEDSFISFA LVPETSAIPFNSYFWELLYAEIGNFICNCIFLLVHSKFKARFLHQQRSLSVRYLLEEISQ TSKFTLIVSFTHLLFVGWYLIATIFVRTIGEDFFGGYIHYTVARGVHITVPTYNLTIVFV GIKALSFMNLRRQNNVQSKVQIRSTGAEGARNYEDAIANYWNFVSRT
Source in vitro E.coli expression system
Gene Names srb-2
Protein Names Recommended name: Serpentine receptor class beta-2 Short name= Protein srb-2
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Nematode receptor-like protein srb family
Database Links

KEGG: cel:CELE_C27D6.9

STRING: 6239.C27D6.9

UniGene: Cel.36896

Related Products

srb-2 Antibodies

srb-2 Antibodies for Caenorhabditis elegans

srb-2 Proteins

srb-2 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.