Recombinant Serpentine receptor class beta-7(srb-7)

Code CSB-CF345740CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P54142
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MNESSTNIPLACITAYELSFHPVYRNFQIYQLIMLFSSLFPLTYFILFQLLKSSFHGNLK SLLVGYFGAILVFSVVFLVEAFIQVLLPFISEQKCDLLIQPKYYKLGNLLGCLLMTIPTF FPISITFERLIATKMADDYEKTRVFLGPILAIFLVLLDLFLILLIYKEAIVTGGSISFVF IPASIASKMYMFFIMMLILNSFNFFFSFLLLRRNAQLKKSNSTLAAKFQLEEVYSSTKFS ISVIFVHVTFFGSYTTITILLRYFGSYFFSDPIDLGAVRGAFMTMISSYNFAVGVASVYF NYIYRIKKIIEIKGNIRIVATGQAGAINYDKAIFNIWNSTSSTNNTSY
Source in vitro E.coli expression system
Gene Names srb-7
Protein Names Recommended name: Serpentine receptor class beta-7 Short name= Protein srb-7
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Nematode receptor-like protein srb family
Database Links

KEGG: cel:CELE_F37C12.17

STRING: 6239.F37C12.17

UniGene: Cel.28756

Related Products

srb-7 Antibodies

srb-7 Antibodies for Caenorhabditis elegans

srb-7 Proteins

srb-7 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.