Recombinant Serpentine receptor class epsilon-27(sre-27)

Code CSB-CF526461CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O62488
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MIIKNMDASTNVPYLWLPIFLYDEPILASQVIASIELILYSICLYIVVVSLKIFVQVRMF HLNFIILVAPFFGIWFELIIGKLITMCYQLSIFSIGNLEIRKFYVLWTDDSNKMLVVNSF EGLELLIIAGFMEYHYMFSVVFGAVAVAIERLAASVLIDNYESTNKIFIPIALTVFFQII AITCSCLALFHKFTIITINGTWIVSCACSSIVFFLVERINLRWKAEMEHPRREKVYTISQ RFQVKENIRALDLGKRLIFSELGTISIIGLIIATLLLELVPPSLVHIAENALFLNPFGIC TVAMYSIPAWKKRYKNAFPSIFCFLMRLKNRKIDVQSMEPLEEFSKRIYEETNIHFAQLN ESWT
Source in vitro E.coli expression system
Gene Names sre-27
Protein Names Recommended name: Serpentine receptor class epsilon-27 Short name= Protein sre-27
Expression Region 1-364
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Nematode receptor-like protein sre family
Database Links

KEGG: cel:CELE_Y57A10C.3

UniGene: Cel.28315

Related Products

sre-27 Antibodies

sre-27 Antibodies for Caenorhabditis elegans

sre-27 Proteins

sre-27 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.