Recombinant Serpentine receptor class gamma-14(srg-14)

Code CSB-CF309718CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P91275
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Caenorhabditis elegans
Sequence MSDFSPDMKNLDIDPIPVDCDLSYNTNIEVLKFTAQIIYIITGIFLNSAVLGTILWRCRE VYSTNSFFTLFSVDCIANISILITEGLFARFFIYFTPICPVLADYFQSPLVGFKIIMLLT HHVSICKSLLQVLLVLNRMTCVLFPITHDSIWRKSLKYVISAVFLIPFCADWNIAISRVY MQSTYGGFWVSYFKKVSWASQSRFQLVFIIIALSFTFICTAITLLKLPERSKEIEKAISN ATVIISIGFTFKVLFQIYYSFFFSYTDASSPVYGFSFLALDFLTVGSPIVMICVSRNLRT HIFKSKRKNQTLSKMLTRTSGMVIAR
Source in vitro E.coli expression system
Gene Names srg-14
Protein Names Recommended name: Serpentine receptor class gamma-14 Short name= Protein srg-14
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Nematode receptor-like protein srg family
Database Links

KEGG: cel:CELE_F26B1.6

UniGene: Cel.26586

Related Products

srg-14 Antibodies

srg-14 Antibodies for Caenorhabditis elegans

srg-14 Proteins

srg-14 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.