Recombinant Serpentine receptor class gamma-14(srg-14)

Code CSB-CF309718CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P91275
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MSDFSPDMKNLDIDPIPVDCDLSYNTNIEVLKFTAQIIYIITGIFLNSAVLGTILWRCRE VYSTNSFFTLFSVDCIANISILITEGLFARFFIYFTPICPVLADYFQSPLVGFKIIMLLT HHVSICKSLLQVLLVLNRMTCVLFPITHDSIWRKSLKYVISAVFLIPFCADWNIAISRVY MQSTYGGFWVSYFKKVSWASQSRFQLVFIIIALSFTFICTAITLLKLPERSKEIEKAISN ATVIISIGFTFKVLFQIYYSFFFSYTDASSPVYGFSFLALDFLTVGSPIVMICVSRNLRT HIFKSKRKNQTLSKMLTRTSGMVIAR
Source in vitro E.coli expression system
Gene Names srg-14
Protein Names Recommended name: Serpentine receptor class gamma-14 Short name= Protein srg-14
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Nematode receptor-like protein srg family
Database Links

KEGG: cel:CELE_F26B1.6

UniGene: Cel.26586

Related Products

srg-14 Antibodies

srg-14 Antibodies for Caenorhabditis elegans

srg-14 Proteins

srg-14 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.