Recombinant Sheep ATP synthase protein 8(MT-ATP8)

Code CSB-CF015071SH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O78751
Storage Buffer Tris-based buffer,50% glycerol
Species Ovis aries (Sheep)
Sequence MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYHNPELMTTKTPKQNTPWETKWTKIYLPLSLPL
Source in vitro E.coli expression system
Gene Names MT-ATP8
Protein Names Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8
Expression Region 1-66
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity).
Subcellular Location Mitochondrion membrane, Single-pass membrane protein
Protein Families ATPase protein 8 family
Database Links

KEGG: oas:808253

Pathway Oxidative Phosphorylation

Related Products

MT-ATP8 Proteins

MT-ATP8 Proteins for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.