Recombinant Simian foamy virus type 1 Envelope glycoprotein gp130 (env)

Code CSB-CF338489SGP
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
env
Uniprot No.
Alternative Names
env; Envelope glycoprotein gp130; Env polyprotein
Species
Simian foamy virus type 1 (SFVmac) (SFV-1)
Expression Region
573-989
Target Protein Sequence
RSVNNYERLRSMGYALTGAVQTLSQISDINDERLQHGVYLLRDHVVTLMEAALHDVSIME GMLAIQHVHTHLNHLKTMLLMRKIDWTFIRSDWIQQQLQKTDDEMKLIRRTARSLVYYVT QTSSSPTATSWEIGIYYEIVIPKHIYLNNWQVINVGHLLESAGHLTHVKVKHPYEIINKE CSDTQYLHLEECIREDYVICDIVQIVQPCGNATELSDCPVTALKVKTPYIQVSPLKNGSY LVLSSTKDCSIPAYVPSVVTVNETVKCFGVEFHKPLYAETKTSYEPQVPHLKLRLPHLTG IIASLQSLEIEVTSTQENIKDQIERAKAQLLRLDIHEGDFPDWLKQVASATRDVWPAAAS FIQGVGNFLSNTAQGIFGSAVSLLFYAKPILIGIGVILLIALLFKIISWLPGKPKKN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The surface protein (SU) attaches the virus to the host cell by binding to the cell receptor. This interaction triggers the refolding of transmembrane protein (TM) and is thought to activate its fusogenic potential by unmasking its fusion peptide.; The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm.; The leader peptide is a component of released, infectious virions and is required for particle budding.
Subcellular Location
[Envelope glycoprotein gp130]: Host endoplasmic reticulum membrane.; [Leader peptide]: Virion membrane; Single-pass type II membrane protein. Host endoplasmic reticulum membrane; Single-pass type II membrane protein.; [Transmembrane protein]: Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Surface protein]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein.
Database Links

KEGG: vg:6386690

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1