Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF639889SZY |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q2MIB3 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Sequence | MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV |
| Source | in vitro E.coli expression system |
| Gene Names | atpH |
| Protein Names | Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein |
| Expression Region | 1-81 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. |
| Subcellular Location | Plastid, chloroplast thylakoid membrane, Multi-pass membrane protein |
| Protein Families | ATPase C chain family |
| Database Links |
KEGG: sly:3950479 STRING: 4081.Solyc09g059660.1.1 |
atpH Proteins for Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP639889SZY1 CSB-EP639889SZY1 CSB-BP639889SZY1 CSB-MP639889SZY1 |
Recombinant Solanum lycopersicum ATP synthase subunit c, chloroplastic(atpH) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Rabbit Integrin beta-8(ITGB8),partial,Yeast
Express system: Yeast
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Human Ribonucleoside-diphosphate reductase large subunit(RRM1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Nuclear transport factor 2(NUTF2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Alpha-2-macroglobulin(A2m),partial
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Mouse Collagen alpha-2(IV) chain(Col4a2),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Mouse Ubiquitin-protein ligase E3A(Ube3a),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Rat Suppressor of cytokine signaling 3(Socs3)
Express system: Yeast
Species: Rattus norvegicus (Rat)
