Recombinant Solanum lycopersicum Probable aquaporin PIP-type pTOM75

Code CSB-CF871510SZY
Size $644
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Uniprot No. Q08451
Alternative Names ; Probable aquaporin PIP-type pTOM75; Ripening-associated membrane protein; RAMP
Species Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Source in vitro E.coli expression system
Expression Region 1-286
Target Protein Sequence MAENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNPGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNDEHAWNDHWIFWVGPMIGAALAAIYHQIIIRAMPFHRS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length Full Length
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families MIP/aquaporin (TC 1.A.8) family, PIP (TC 1.A.8.11) subfamily
Tissue Specificity Roots, ripening fruit and senescing leaves.
Database Links

KEGG: sly:544086

STRING: 4081.Solyc08g081190.2.1

UniGene: Les.4158

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1