Recombinant Solanum tuberosum Hexokinase-1(HXK1)

Code CSB-CF010468FIG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O64390
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Solanum tuberosum (Potato)
Sequence MKKVTVGAAVVGAAAVCAVAALIVNHRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGQSSRCLSPMSIISQLVMKLGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALFDYIAAELAKFVAAEEEKFHQPPGKQRELGFHLLIPSNADFNNSGTIMRWTKGFSIDDAVGQDVVGELTKAMKEKVLDMRVSALVNDTVGTLAGGKYTQKDVAVAVILGTGTNAAYVERVQAIPKWHGPVPKSGEMVINMEWGNFRSSHLPLTEYDHALDNESLNPAEQIFEKMTSGMYLGEILRRVLTRVAEEVLAFLAMRSLQSLKDSFVLRTPDMSAMHHDTSPDLKVVGEKLKDILEISNTSLKTRKLVLSLCNIVATRGARLDAAGVLGILKKMGRDTPKQGGSERTVIAMDGGLYEHYTEYRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLRASHSMYLEDQA
Source in vitro E.coli expression system
Gene Names HXK1
Protein Names Recommended name: Hexokinase-1 EC= 2.7.1.1 Alternative name(s): StHK1
Expression Region 1-498
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Fructose and glucose phosphorylating enzyme. May be involved in the phosphorylation of glucose during the export from plastids to cytosol. Seems neither to be involved in cell sugar sensing nor in carbohydrate metabolism in tuber.
Subcellular Location Plastid, chloroplast outer membrane, Single-pass membrane protein
Protein Families Hexokinase family
Tissue Specificity Expressed in young and mature leaves, stems, roots, stolons, and developing and mature tubers.
Database Links

KEGG: sot:102604144

UniGene: Stu.19430

Related Products

HXK1 Antibodies

HXK1 Antibodies for Solanum tuberosum (Potato)

HXK1 Proteins

HXK1 Proteins for Solanum tuberosum (Potato)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.