Recombinant Synaptotagmin-1(snt-1)

Code CSB-CF023029CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P34693
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MVKLDFSSQDEENDEDLTKEFVRDEAPMEETTSEAVKQIATTTKETLKDVVVNKVIDVKDVVKEKVMQQTGMPEWAFVFLGFVFILLVLACAFCLIRKLFGKKRHGEKNKKGGLKGFFGKGQDVVDGKNIQGMAQDLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEEGDKKDDKK
Source in vitro E.coli expression system
Gene Names snt-1
Protein Names Recommended name: Synaptotagmin-1 Alternative name(s): Synaptotagmin I
Expression Region 1-441
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone (By similarity). Involved in necrotic cell death
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass membrane protein, Cell junction, synapse
Protein Families Synaptotagmin family
Tissue Specificity Localized to regions known to be rich in synapses and appears to be associated with synaptic vesicles. Also found in some non-neuronal secretory structures.
Database Links

STRING: 6239.F31E8.2b

UniGene: Cel.18270

Related Products

snt-1 Antibodies

snt-1 Antibodies for Caenorhabditis elegans

snt-1 Proteins

snt-1 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.