Recombinant Synechococcus elongatus ATP synthase subunit c(atpE)

Code CSB-CF657433FPY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q31RF5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Sequence MDSLTSAASVLAAALAVGLAAIGPGIGQGSAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA
Source in vitro E.coli expression system
Gene Names atpE
Protein Names Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families ATPase C chain family
Database Links

KEGG: syf:Synpcc7942_0332

STRING: 1140.Synpcc7942_0332

Related Products

atpE Antibodies

atpE Antibodies for Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

atpE Proteins

atpE Proteins for Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.