Recombinant Takifugu rubripes 5-hydroxytryptamine receptor 1A-beta(htr1a-B)

Code CSB-CF523638TKY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O42384
Storage Buffer Tris-based buffer,50% glycerol
Species Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
Sequence MEGTNNTTGWTHFDSTSNRTSKSFDEEVKLSYQVVTSFLLGALILCSIFGNACVVAAIAL ERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNRWTLGQIPCDIFISLDMLCCTSS ILHLCVIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISIPPMLIMRSQPSSMA EDRANSKQCKITQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRIRRTVRKTEKKKV SDTCLALSPAMFHRKTPGDAHGKSWKRSVEPRPLPNVNGAVKHAGEGESLDIIEVQSNSR CNLPLPNTPGTVPLFENRHEKATETKRKIALARERKTVKTLGIIMGTFILCWLPFFIVAL VMPFCQESCFMPHWLKDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCHFCRA
Source in vitro E.coli expression system
Gene Names htr1a-B
Protein Names Recommended name: 5-hydroxytryptamine receptor 1A-beta Short name= 5-HT-1A-beta Short name= 5-HT1A-beta Alternative name(s): F1B Serotonin receptor 1A-beta
Expression Region 1-416
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity and behavior (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, 5-hydroxytryptamine receptor subfamily
Database Links

KEGG: tru:101072291

Related Products

htr1a-B Proteins

htr1a-B Proteins for Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.