Recombinant UPF0073 inner membrane protein yqfA(yqfA)

Code CSB-CF354882SZB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P67156
Storage Buffer Tris-based buffer,50% glycerol
Species Shigella flexneri
Sequence MVQKPLIKQGYSLAEEIANSVSHGIGLVFGIVGLVLLLVQAVDLNASATAITSYSLYGGS MILLFLASTLYHAIPHQRAKMWLKKFDHCAIYLLIAGTYTPFLLVGLDSPLARGLMIVIW SLALLGILFKLTIAHRFKILSLVTYLAMGWLSLVVIYEMAVKLAAGSVTLLAVGGVVYSL GVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYIGQA
Source in vitro E.coli expression system
Gene Names yqfA
Protein Names Recommended name: UPF0073 inner membrane protein yqfA
Expression Region 1-219
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0073 (Hly-III) family
Database Links

KEGG: sfl:SF2885

Related Products

yqfA Antibodies

yqfA Antibodies for Shigella flexneri

yqfA Proteins

yqfA Proteins for Shigella flexneri

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.