Recombinant UPF0073 inner membrane protein yqfA(yqfA)

Code CSB-CF355480EGX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P67154
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Sequence MVQKPLIKQGYSLAEEIANSVSHGIGLVFGIVGLVLLLVQAVDLNASATAITSYSLYGGS MILLFLASTLYHAIPHQRAKMWLKKFDHCAIYLLIAGTYTPFLLVGLDSPLARGLMIVIW SLALLGILFKLTIAHRFKILSLVTYLAMGWLSLVVIYEMAVKLAAGSVTLLAVGGVVYSL GVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYIGQA
Source in vitro E.coli expression system
Gene Names yqfA
Protein Names Recommended name: UPF0073 inner membrane protein yqfA
Expression Region 1-219
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0073 (Hly-III) family
Database Links

KEGG: ecc:c3480

STRING: 199310.c3480

Related Products

yqfA Antibodies

yqfA Antibodies for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

yqfA Proteins

yqfA Proteins for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.