Recombinant Uncharacterized 9.5 kDa protein in ORF3 5'region(xpaL2)

Code CSB-CF859916BQT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99165
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus licheniformis
Sequence MKHIDKGTVVRTVLLFIALVNQTLIMFGKPVLPVAEDQIHTLADALYSAGSAAFTIAASL VAWYKNNYVTSKGKMQKEVLQKKGLTK
Source in vitro E.coli expression system
Gene Names xpaL2
Protein Names Recommended name: Uncharacterized 9.5 kDa protein in ORF3 5'region
Expression Region 1-87
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families SPP1 holin family

Related Products

xpaL2 Antibodies

xpaL2 Antibodies for Bacillus licheniformis

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.