Recombinant Uncharacterized protein C03F11.1(C03F11.1)

Code CSB-CF606124CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q11122
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MKHEQRKHSDFWKRRKISQSAMVTQCESNGSVTSHNTSSAFQRNNSRYGVPIDSTAVKQV YRVRSERLTNRVRITDRSLYLALFGVILMLVESEITAEKFYGVSKTHWISQSLRVGVTCS TIALLYHIILYHLNDIVLELVDCGADDWRVVVTTERVIQFCIEFICCGICPLPGSGEMKW TFIEPSLHKDGPSEERTVQTRNVDVPVDVILSCFMLCRSYLFARFMVLHSKQFQDASTRT LAALNRIQVNFSFVIKTSLDQQPVLFLTTFTFIFWIIMSWMFVQCERYGFSGKNPQSILY SNSLWFIAITFMLNGYGDIVPQTNAGRFIAIFVGVVGAVISSILIAVISRNILLSQGQRN VNNFMYDSKLAREHKEAAARVLQHTWHIHKCLQGSDGGNRRLRTYQRKFLKAIHKFRSVK SEMREFSENNSQNNPQMTRLVTDMHTSMQRLLNVQDEMRMQIEVVKFVLKK
Source in vitro E.coli expression system
Gene Names kcnl-3
Protein Names Recommended name: Uncharacterized protein C03F11.1
Expression Region 1-471
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms a voltage-independent potassium channel activated by intracellular calcium.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Potassium channel KCNN family, SK subfamily
Database Links

KEGG: cel:CELE_C03F11.1

STRING: 6239.C03F11.1

UniGene: Cel.25677

Related Products

kcnl-3 Antibodies

kcnl-3 Antibodies for Caenorhabditis elegans

kcnl-3 Proteins

kcnl-3 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.