Recombinant Vibrio harveyi Electron transport complex protein RnfA(rnfA)

Code CSB-CF417748VEA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7MVC5
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Sequence MTEYILLLVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAYLVE SYVLRPLGIEYLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINENHNFIESIIYGFGAAVGFSLVLILFASMRERIAAADVPVPFRGASIAMITAGLM SLAFMGFTGLVK
Source in vitro E.coli expression system
Gene Names VIBHAR_02964
Protein Names Recommended name: Electron transport complex protein RnfA
Expression Region 1-192
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a membrane complex involved in electron transport.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families NqrDE/RnfAE family
Database Links

KEGG: vca:M892_16155

STRING: 338187.VIBHAR_02964

Related Products

VIBHAR_02964 Proteins

VIBHAR_02964 Proteins for Vibrio campbellii (strain ATCC BAA-1116 / BB120)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.