Recombinant Walleye dermal sarcoma virus ORF-B protein

Code CSB-CF773330WBH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q88940
Storage Buffer Tris-based buffer,50% glycerol
Species Walleye dermal sarcoma virus (WDSV)
Sequence MFSDSDSSDEELSRIITDIDESPQDIQQSLHLRAGVSPEARVPPGGLTQEEWTIDYFSTY HTPLLNPGIPHELTQRCTDYTASILRRASAKMIQWDYVFYLLPRVWIMFPFIAREGLSHL THLLTLTTSVLSATSLVFGWDLTVIELCNEMNIQGVYLPEVIEWLAQFSFLFTHVTLIVV SDGMMDLLLMFPMDIEEQPLAINIALHALQTSYTIMTPILFASPLLRIISCVLYACGHCP SARMLYAYTIMNRYTGESIAEMHTGFRCFRDQMIAYDMEFTNFLRDLTEEETPVLEITEP EPSPTE
Source in vitro E.coli expression system
Protein Names Recommended name: ORF-B protein
Expression Region 1-306
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Host cytoplasm, Host cell membrane, Multi-pass membrane protein
Database Links

KEGG: vg:1403499

Related Products

Antibodies

Antibodies for Walleye dermal sarcoma virus (WDSV)

Proteins

Proteins for Walleye dermal sarcoma virus (WDSV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.