Recombinant Xenopus tropicalis Hyaluronan synthase 1(has1)

Code CSB-CF010139XBF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B1WB39
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Sequence MKDKAAATMEIPEDPGIPKNLERKRPIVWRMIYYSFAVLLLAAFTAAYVTEFQILTHEDV LFSLGLYGLVMFLHLMMQSLFAYLEIRRINKTDLPCSFKKTVALTIAGYQENPDYLKHCL DSCRYVKYPKDKLKIILVIDGNTEDDAYMMEMFKDVFHGDDVGTYVWKGNYHTGVKETQD GSCPEVSKPLNEDEGIRIVEELVRTKRCVCIMQQWGGKREVMYTAFRAIGTTMDYVQVCD SDTKLDELATVEMVKVLEANELCGAVGGDVRILNPYDSFISFMSSLRYWMAFNVERACQS YFDCVSCISGPLGMYRNDILQVFLEAWHSQKFLGTYCTLGDDRHLTNRVLSMGYRTKYTP KCRAFSETPSQYLRWLNQQTRWTKSYFREWLYNAQWWYKHHIWMTYESVVHFIFPFFITA TVIRLLYASTIWNVVWLLLCIQIMSVLKSLYACWLRGNPIMLLMSLYSMLYMTGLLPSKY FAMLTINKSGWGTSGRKKIVGNYMPVLPLSIWMAVLCGGVGYSIYMDCHQDWSTPEKQKE LYHLLYGCISYTLYWVLMALMYWVWVKRCCRKRSQTVTLVHDIPERLVCK
Source in vitro E.coli expression system
Gene Names has1
Protein Names Recommended name: Hyaluronan synthase 1 EC= 2.4.1.212 Alternative name(s): Hyaluronate synthase 1 Hyaluronic acid synthase 1 Short name= HA synthase 1
Expression Region 1-590
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. Also able to catalyze the synthesis of chito-oligosaccharide depending on the substrate (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families NodC/HAS family
Database Links

KEGG: xtr:100145746

UniGene: Str.8178

Related Products

has1 Proteins

has1 Proteins for Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.