Recombinant Xenopus tropicalis Vacuole membrane protein 1(vmp1)

Code CSB-CF731566XBF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q68EQ9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Sequence MAENGTDCEQRRVGMAKEQNNGSFQDPSFLSDRKSRDREERQSIVLWRKPLITLQYFILE VLITLKDWSIRLWHRRMMVVSVLLLLAVLSVVYYIEGTHQQYVQYVEKKCLWCAYWVGLG ILSSVGLGTGLHTFLLYLGPHIASVTIAAYECNSVNFPEPPYPDEIICPDEEGTEGAISL WTIISKVRLEACMWGAGTAIGELPPYFMARAARLSGVETDDEEYAEFEEMLEHAQTAQDF ATRAKLAVQNLVQKVGFLGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKLFVIITFSKHIVEQMVSLIGVIPSIGPSLQKPFQEYLEAQRKKLHHKEDSGAPQS ENWLSWAFEKLVIIMVFYFILSIINSMAQSYAKRVQQRKLSVEKTK
Source in vitro E.coli expression system
Gene Names vmp1
Protein Names Recommended name: Vacuole membrane protein 1 Alternative name(s): Transmembrane protein 49
Expression Region 1-406
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Vacuole membrane, Multi-pass membrane protein, Endoplasmic reticulum
Protein Families VMP1 family
Database Links

KEGG: xtr:493262

STRING: 8364.ENSXETP00000023484

UniGene: Str.11181

Pathway Autophagy

Related Products

vmp1 Proteins

vmp1 Proteins for Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.