Recombinant Xenopus tropicalis Vang-like protein 2(vangl2)

Code CSB-CF700344XBF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4VBG5
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Sequence MDNDSQYSGYSYKSGHSRSSRKHRDRRERHRSKSREGSRGDKSVTIQAPGEPLLDNESTR GEDRDDNWGETTTVVTGTSEHSISHDDITRITKDMEDSAKLDCSRHLGVVIGGALALLSF LTPIAFMLLPQILWREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFV FRALLMVLVFLLVVSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELR QLQPQFTVKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSK KMSGFKVYSLGEENTTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLV VAVEEAFTHIKRLQDEDQKNPREIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LHHLEFCITHDMTPKAFLERYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVL KRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV
Source in vitro E.coli expression system
Gene Names vangl2
Protein Names Recommended name: Vang-like protein 2 Alternative name(s): Protein strabismus Van Gogh-like protein 2
Expression Region 1-521
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a role in non-canonical Wnt/planar cell polarity (PCP) signaling; can recruite dvl/dsh and prickle from the cytoplasm to the plasma membrane. Acts in a PCP complex to regulate the polarized assembly of fibronectrin on the surface of the mesoderm during gastrulation. Regulates convergent extension in both dorsal mesoderm and neural tissue without affecting cell fate. Regulates neural fold closure during neurulation. May be required for cell surface localization of fzd3 and fzd6 in the inner ear (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Vang family
Database Links

KEGG: xtr:613073

STRING: 8364.ENSXETP00000012852

UniGene: Str.11014

Pathway Wnt signaling pathway

Related Products

vangl2 Proteins

vangl2 Proteins for Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.