Recombinant Zinc transport protein ZntB(zntB)

Code CSB-CF771047SZB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q83KS5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Shigella flexneri
Sequence MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRFGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Source in vitro E.coli expression system
Gene Names zntB
Protein Names Recommended name: Zinc transport protein ZntB
Expression Region 1-327
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates efflux of zinc ions.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families CorA metal ion transporter (MIT) (TC 1.A.35) family
Database Links

KEGG: sfl:SF1827

Related Products

zntB Antibodies

zntB Antibodies for Shigella flexneri

zntB Proteins

zntB Proteins for Shigella flexneri

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.