ZNF699 Antibody

Code CSB-PA026960LA01HU
Size US$166
Order now
Image
  • Western blot
    All lanes: ZNF699 antibody at 2µg/ml
    Lane 1: Jurkat whole cell lysate
    Lane 2: K562 whole cell lysate
    Lane 3: U87 whole cell lysate
    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
    Predicted band size: 74 kDa
    Observed band size: 74 kDa

  • Immunohistochemistry of paraffin-embedded human brain tissue using CSB-PA026960LA01HU at dilution of 1:100

  • Immunohistochemistry of paraffin-embedded human endometrial cancer using CSB-PA026960LA01HU at dilution of 1:100

Promotion Free Antibody trial simple
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Full Product Name
Rabbit anti-Homo sapiens (Human) ZNF699 Polyclonal antibody
Uniprot No.
Target Names
ZNF699
Alternative Names
FLJ38144 antibody; hang antibody; Hangover homolog antibody; hangover; Drosophila; homolog of antibody; MGC129880 antibody; MGC129881 antibody; Zinc finger protein 699 antibody; ZN699_HUMAN antibody; ZNF699 antibody
Raised in
Rabbit
Species Reactivity
Human
Immunogen
Recombinant Human Zinc finger protein 699 protein (19-195AA)
Immunogen Species
Homo sapiens (Human)
Conjugate
Non-conjugated

The ZNF699 Antibody (Product code: CSB-PA026960LA01HU) is Non-conjugated. For ZNF699 Antibody with conjugates, please check the following table.

Available Conjugates
Conjugate Product Code Product Name Application
HRP CSB-PA026960LB01HU ZNF699 Antibody, HRP conjugated ELISA
FITC CSB-PA026960LC01HU ZNF699 Antibody, FITC conjugated
Biotin CSB-PA026960LD01HU ZNF699 Antibody, Biotin conjugated ELISA
Clonality
Polyclonal
Isotype
IgG
Purification Method
>95%, Protein G purified
Concentration
It differs from different batches. Please contact us to confirm it.
Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, PH 7.4
Form
Liquid
Tested Applications
ELISA, WB, IHC
Recommended Dilution
Application Recommended Dilution
WB 1:500-1:2000
IHC 1:20-1:200
Troubleshooting and FAQs
Storage
Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time maybe differs from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Usage
For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Hi, I am interested if this ZNF699 Antibody is a C-terminal one?

A:

The ZNF699 Antibody (CSB-PA026960LA01HU) was raised against N-terminal sequence of human ZNF699. I provided below the exact immunogen sequence, hope this will be helpful.
Immunogen: Recombinant Human Zinc finger protein 699 protein (19-195aa)
Sequence: VVFEDVAVDFTQEEWALLDLAQRNLYRDVMLENFQNLASLGYPLHTPHLISQWEQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKIVRFKRNDSWFSSLHENQESCGIDYQNKSHERHLRNHMVENIYECYEENQDGQTFSQVPNLDSLKRNTEVKSC

Target Background

Function
May be involved in transcriptional regulation.
Gene References into Functions
  1. Results show no associations between polymorphisms in ZNF699 and alcohol dependence per se but s significant allelic association was found between rs7254880 in ZNF699 and alcohol-related cirrhosis. PMID: 26368818
  2. In analyses of genetically independent cases and controls, four of the seven single markers show strong evidence for association with alcohol dependence, and the most significant single marker, rs7254880, tags an associated haplotype with frequency 0.071. PMID: 16940975
  3. Observational study of gene-disease association. (HuGE Navigator) PMID: 16940975
Subcellular Location
Nucleus.
Protein Families
Krueppel C2H2-type zinc-finger protein family
Database Links

HGNC: 24750

OMIM: 609571

KEGG: hsa:374879

STRING: 9606.ENSP00000311596

UniGene: Hs.633842

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*