Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

lepB

Uniprot No.

P00803

Research Area

Microbiology

Alternative Names

lepB; b2568; JW2552; Signal peptidase I; SPase I; EC 3.4.21.89; Leader peptidase I

Species

Escherichia coli (strain K12)

Source

E.coli

Expression Region

78-324aa

Target Protein Sequence

RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

43.7kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 78-324 form the expressed segment for recombinant Escherichia coli (strain K12) lepB. The expected molecular weight for the lepB protein is calculated to be 43.7 kDa. This lepB recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of lepB, which enables a simple process of detecting and purifying the lepB recombinant protein in the following steps.

Signal peptidase I (LepB) is an enzyme in Escherichia coli that plays a crucial role in protein maturation by cleaving signal peptides from newly synthesized proteins in the bacterial cell. LepB specifically recognizes and cleaves the signal peptides at the conserved signal peptidase cleavage site, releasing the nascent protein into the periplasmic space. This process is essential for the proper localization and functionality of secreted or membrane-bound proteins. Understanding the function of LepB is vital for unraveling the intricacies of bacterial protein secretion and membrane targeting, with potential applications in biotechnology and antibiotic development.

Code	CSB-EP360447ENV
Abbreviation	Recombinant E.coli lepB protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli Signal peptidase I (lepB), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage