Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
lepB; b2568; JW2552; Signal peptidase I; SPase I; EC 3.4.21.89; Leader peptidase I
Species
Escherichia coli (strain K12)
Expression Region
78-324aa
Target Protein Sequence
RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 78-324 form the expressed segment for recombinant Escherichia coli (strain K12) lepB. The expected molecular weight for the lepB protein is calculated to be 43.7 kDa. This lepB recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of lepB, which enables a simple process of detecting and purifying the lepB recombinant protein in the following steps.
Signal peptidase I (LepB) is an enzyme in Escherichia coli that plays a crucial role in protein maturation by cleaving signal peptides from newly synthesized proteins in the bacterial cell. LepB specifically recognizes and cleaves the signal peptides at the conserved signal peptidase cleavage site, releasing the nascent protein into the periplasmic space. This process is essential for the proper localization and functionality of secreted or membrane-bound proteins. Understanding the function of LepB is vital for unraveling the intricacies of bacterial protein secretion and membrane targeting, with potential applications in biotechnology and antibiotic development.
