Recombinant Escherichia coli Signal peptidase I (lepB), partial

In Stock
Code CSB-EP360447ENV
Abbreviation Recombinant E.coli lepB protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
lepB
Uniprot No.
Research Area
Microbiology
Alternative Names
lepB; b2568; JW2552; Signal peptidase I; SPase I; EC 3.4.21.89; Leader peptidase I
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
78-324aa
Target Protein Sequence
RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 78-324 form the expressed segment for recombinant Escherichia coli (strain K12) lepB. The expected molecular weight for the lepB protein is calculated to be 43.7 kDa. This lepB recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of lepB, which enables a simple process of detecting and purifying the lepB recombinant protein in the following steps.

Signal peptidase I (LepB) is an enzyme in Escherichia coli that plays a crucial role in protein maturation by cleaving signal peptides from newly synthesized proteins in the bacterial cell. LepB specifically recognizes and cleaves the signal peptides at the conserved signal peptidase cleavage site, releasing the nascent protein into the periplasmic space. This process is essential for the proper localization and functionality of secreted or membrane-bound proteins. Understanding the function of LepB is vital for unraveling the intricacies of bacterial protein secretion and membrane targeting, with potential applications in biotechnology and antibiotic development.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. LepB promote the association of the central domain of colicin D with the inner membrane and translocation of the toxic tRNase domain into the cytoplasm. PMID: 26499796
  2. Ile-144 and Ile-86 contribute to the signal peptidase substrate specificity and Ile-144 is important for the accuracy of the cleavage reaction PMID: 15598653
  3. Ile-144 and Ile-86 are key P3 substrate specificity determinants for signal peptidase I PMID: 17077081
  4. A thorough investigation of different roles of Escherichia coli type I signal peptidase residues binding to lipopeptide inhibitor has been performed by a combination of computational alanine scanning mutagenesis and free energy decomposition methods. PMID: 17532654
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Protein Families
Peptidase S26 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*