| Code | CSB-EP005599HU |
| Abbreviation | Recombinant Human CMA1 protein |
| MSDS | |
| Size | US$306 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I requested for the following information. Kindly provide assistance
1.CSB-EP005599HU, Recombinant Human Chymase(CMA1)
2.Availability of 200 ug size and delivery lead time
3.Is the product biologically active?
4.Price of 200 ug
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN