Recombinant Human Galectin-7 (LGALS7)

Code CSB-EP012892HU
Abbreviation Recombinant Human LGALS7 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
LGALS7
Uniprot No.
Research Area
Neuroscience
Alternative Names
Gal-7; GAL7; Galectin 7B; Galectin-7; HKL-14; Human keratinocyte lectin 14 ; Keratinocyte lectin 14; Lectin galactoside binding soluble 7; Lectin; galactoside binding; soluble; 7B; LEG7_HUMAN; LGALS7; LGALS7A; LGALS7B; P53 induced protein 1; p53-induced gene 1 protein; Pi7; PIG1; TP53I1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-136aa
Target Protein Sequence
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
Gene References into Functions
  1. Increased O-linked N-Acetyl-glucosamine (O-GlcNAc) is responsible for reduced Gal-7 expression in cultured human keratinocytes exposed to high glucose environment. PMID: 28526214
  2. We observed a significantly reduced overall survival for cases with high Gal-7 expression and a better survival for Gal-7 negative cases, when compared to cases with low expression of Gal-7. PMID: 28594391
  3. Data suggest that evaluation of galectin-7 could help guide postsurgical management for non-metastatic clear cell renal cell carcinoma (ccRCC). PMID: 27259255
  4. these findings reveal the existence of a positive self-amplification pathway that regulates intracellular gal-7 expression in breast and ovarian cancer cells. PMID: 29117220
  5. Gal-7 re-expression affects the regulation of molecular networks in cervical cancer that are involved in diverse cancer hallmarks, such as metabolism, growth control, invasion and evasion of apoptosis PMID: 27558259
  6. Measurement of scGal-7 content in tape-stripped samples was useful for the evaluation of the skin barrier function in dry skin conditions such as AD PMID: 27028525
  7. Data indicate that the galectin inhibitor specifically binds galectin-7 (hGal-7), disrupts the formation of homodimers, and inhibits the pro-apoptotic activity of hGal-7 on Jurkat T cells. PMID: 26543238
  8. Galectin-7 regulates keratinocytes proliferation and differentiation through JNK1 pathway. PMID: 26763438
  9. The assessment of a carbohydrate-recognition domain (CRD)-defective mutant form of gal-7 (R7S) showed that the ability of this protein to modulate apoptosis was independent of its CRD activity. PMID: 26168167
  10. our study validates the clinical significance of gal-7 overexpression in ovarian cancer PMID: 25277199
  11. Cytosolic galectin-7 impairs p53 functions and induces chemoresistance in breast cancer cells. PMID: 25367122
  12. Galectin-7 is produced by the premenstrual and menstrual endometrium, where it accumulates in menstrual fluid and likely acts as a paracrine factor to facilitate post-menstrual endometrial re-epithelialization. PMID: 24782449
  13. Understanding how these dendrimeric compounds interact with hGal-7 would help in the design of new tools to investigate the recognition of carbohydrates by lectins. PMID: 25367374
  14. galectin-7 is a potential predictive marker of chemotherapy and/or radiotherapy resistance in patients with oral squamous cell carcinoma PMID: 24515895
  15. galectin-7 may have a role in amyloidogenesis of primary localized cutaneous amyloidosis PMID: 25172508
  16. C/EBPbeta is an important mediator of galectin-7 gene activation in breast cancer cells PMID: 24789216
  17. Galectin-7 is produced by endometrial epithelium. It is elevated in the endometrium of women with history of miscarriage. We suggest that galectin-7 facilitates adhesion of embryo to endometrium. Elevated galectin-7 may result in abnormal adhesion. PMID: 24522232
  18. galectin-7 may play important roles in downregulating the functions of T lymphocytes after UVB irradiation PMID: 24134186
  19. galectin-7 has a tumor suppressive function, and that the gene is epigenetically modified by DNA methylation and significantly down-regulated in gastric cancer. PMID: 23985992
  20. Suggest that the differences in galectin-7 expression and subcellular and extracellular distribution may be crucially involved in the pathogenic process of hypertrophic scars. PMID: 23493985
  21. galectin-7 could be part of a common pathway used by mutant p53 to promote cancer progression PMID: 23967302
  22. The results indicate that lactose binding to human Gal-7 induces long-range effects (minor conformational shifts and changes in structural dynamics) throughout the protein that result in stabilization of the dimer state, with evidence for positive cooperativity. PMID: 23376190
  23. High GAL-7 expression is associated with epithelial ovarian cancer. PMID: 23564797
  24. Knocking down galectin-7 or S100A9 enhanced tumor cell invasion. PMID: 22864818
  25. Because residual cholesteatoma matrix is considered to be one of the main causes of cholesteatoma recurrence, staining with galectin-7 at the time of operation would be a promising way to facilitate complete removal of the residue PMID: 22377647
  26. Extracellular superoxide dismutase plays a role not only as a reactive oxygen species scavenger, but also as a pro-apoptotic factor via COX-2/galectin-7 pathways in the epidermis. PMID: 22251572
  27. high resolution crystal structure of Gal-7 at 1.4 A (a dimer) and its 1.7 A structure in complex with an inhibitor, a sulfur-containing 2-O-benzylphosphate galactoside, a possible antineoplastic agent PMID: 22059385
  28. Data suggest that the binding of Galectin 7 to Bcl-2 may constitute a new target for enhancing the intrinsic apoptosis pathway. PMID: 21289092
  29. Galectin-7 modulates the length of the primary cilia and wound repair in polarized kidney epithelial cells. PMID: 21677144
  30. Data show that high levels of galectin-7 expression in breast cancer cells drastically increased their ability to metastasize to lungs and bones, and were restricted to high-grade breast carcinomas. PMID: 20382700
  31. Proteomics analysis revealed that galectin-7 was highly expressed in esophageal squamous cell carcinoma and could be used as a potential biomarker. PMID: 20546628
  32. Data show that Galectine-7 gene was 8 times up-regulated in bronchial epithelial cells from asthmatic children after RSV infection in vitro and overexpressed in bronchial epithelial cells in asthma in vivo. PMID: 17044979
  33. galectin-7 increases the expression of MMP-9 through the p38 MAPK signaling pathway PMID: 19885589
  34. GAL7 is a negative growth regulator for human neuroblastoma cells. PMID: 13679866
  35. High levels of galectin 7 expression were associated with rapid recurrence rates in hypopharyngeal cancer PMID: 16788763
  36. there was no significant difference in Galectin 7 expression in thyroid tissue in thyroid cancer cases compared to non-cancer cases PMID: 18418527
  37. Gal-7 influence on differentiation in vivo, without evidence for a role in dissemination in head and neck squamous and basal cell carcinomas PMID: 19012243
  38. abnormal expression of galectin-7 in lymphoma cells is not dependent on p53, but is rather associated with DNA hypomethylation. PMID: 19596268

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Secreted. Note=May be secreted by a non-classical secretory pathway.
Tissue Specificity
Mainly expressed in stratified squamous epithelium.
Database Links

HGNC: 6568

OMIM: 600615

KEGG: hsa:3963

STRING: 9606.ENSP00000367891

UniGene: Hs.558355

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*