Recombinant Human Aquaporin-3 (AQP3)

Code CSB-CF849752HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
AQP3; Aquaporin-3; AQP-3; Aquaglyceroporin-3
Species
Homo sapiens (Human)
Expression Region
1-292
Target Protein Sequence
MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN LAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF GLYYDAIWHFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVD PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQ HWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Water channel required to promote glycerol permeability and water transport across cell membranes. Acts as a glycerol transporter in skin and plays an important role in regulating SC (stratum corneum) and epidermal glycerol content. Involved in skin hydration, wound healing, and tumorigenesis. Provides kidney medullary collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Slightly permeable to urea and may function as a water and urea exit mechanism in antidiuresis in collecting duct cells. It may play an important role in gastrointestinal tract water transport and in glycerol metabolism.
Gene References into Functions
  1. the present data suggest that expression of AQP3 and 5 may be a marker for distinguishing between patients with dry mouth and those with Sjogren's syndrome PMID: 29925705
  2. Expression of AQP3 was markedly upregulated and miR-488 was significantly upregulated in osteosarcoma (OS) tissues and cell lines. miR488 inhibited the proliferation, invasion and epithelial-mesenchymal transition (EMT) of OS cells by directly downregulating AQP3 expression, and miR488 targeting AQP3 was responsible for inhibition of the proliferation, invasion and EMT of OS cells. PMID: 30015825
  3. TFF peptides promptly produced at sites of injury increase AQP levels, most notably AQP3, thereby enhancing the cells' ability to rapidly change their shape as part of the restitutive process. TFF peptides also require functioning AQP3 channels to induce cell migration. PMID: 29046361
  4. an altered expression of placental AQP3 may produce failures in placentation such as in preeclampsia. PMID: 29567477
  5. Data show that AQP3 is localized largely in the cytoplasm and can be targeted to the plasma membrane in prostate cancer cells via a cAMP/PKA/RalA pathway. PMID: 29532894
  6. placental expression reduced in pre-eclampsia PMID: 29108637
  7. In response to injury, AQP3-depleted colonic epithelial cells showed defective lamellipodia, focal adhesions, and repair after wounding, along with impaired H2O2 responses after exposure to the intestinal pathogen Citrobacter rodentium. PMID: 28049834
  8. AQP3 siRNA and PLD2 siRNA significantly downregulated the mRNA and protein levels of AQP3 and PLD2 in the A431 cells; inhibiting proliferation and promoting apoptosis in vitro. PMID: 28656282
  9. Reduced epidermal AQP-3 may have a role in impaired melanocyte survival in vitiligo, and might be a potential negative biological marker for vitiligo activity PMID: 26923934
  10. provide evidence for the involvement of the JNK pathway in AQP3 regulation in isolated oligohydramnios tissues in vitro, in amniotic epithelial cells derived from normal amniotic fluid and fluid from patients with isolated oligohydramnios PMID: 27814615
  11. Results indicate that AQP3 promotes stem-like properties of gastric carcinoma (GC) cells by activating the Wnt/GSK-3beta/beta-catenin signaling pathway. PMID: 26918728
  12. The Adiponectin increases AQP3 expression through PPARalpha-mediated signaling inhepatic stellate cells. PMID: 28595905
  13. skin dryness observed in intrinsic and extrinsic aged skin may be explained, at least in part, by AQP3 downregulation. This may open new avenues sufficient to control skin texture and beauty. Its interaction in skin protein organization and gene polymorphism can also be tackled in future research PMID: 26509906
  14. epigenetic signatures at AQP3 and SOCS3 engage in low-grade inflammation across different tissues, possible via JAK/STAT mediated pathways PMID: 27824951
  15. RNA interference (RNAi) of aquaporin 3 (AQP3) retarded the growth and invasiveness of XWLC-05 lung cancer cells and decreased the activity of matrix metalloproteinase 2 (MMP2). PMID: 28189680
  16. Taken together, our data, as a proof of principle, suggest that AQP3 can promote tumor growth of pancreatic cancer cells by activating the Mtor signaling pathway and provide a potential therapeutic target in the treatment of PDAC. PMID: 28377226
  17. AQP3 was upregulated, and AQP7 and AQP9 were downregulated in hepatocellular carcinoma. A high expression of AQP3 and low expression of AQP7 was significantly associated with the aggressive features of hepatocellular carcinoma. PMID: 27121567
  18. AQP3 inhibition that induced glycerol uptake reduction and glycerol administration would rehabilitate the cell proliferation. PMID: 26768614
  19. AQP3 increases in hepatocellular carcinoma. Auphen reduces AQP3 levels, suppressing tumor growth. PMID: 27022216
  20. roles of AQP-3 in AQP-3 aquaglyceroporin and ClC-3 chloride channels complex PMID: 26794461
  21. treatment of human HepG2 cells with TCDD also increased the expression of AQP3 mRNA and protein PMID: 26454884
  22. AQP3 knockdown retards the growth of NSCLC cells partially through inhibiting HIF-1alpha/VEGF and Raf/MEK/ERK signalling pathways. PMID: 26765123
  23. AQP3 was found to be expressed in 67.71% of parts with GIM, and AQP3 immunoreactivity was identified more frequently in severe GIM areas (P < 0.001). In short, the incidence and severity of GIM correlated with the distance from GC, and AQP3 was differentially expressed in goblet cells, with most AQP3-positive goblet cells presenting in severe GIM. PMID: 26506416
  24. AQP3 was expressed in trophoblast explants. Blocking it with CuSO4 prevented apoptosis. PMID: 26568619
  25. Expression of CXCL4 and aquaporin 3 and 10 mRNAs in middle ear effusion is associated with the pathophysiology of otitis media with effusion. PMID: 26810286
  26. results demonstrate that AQP3 is required for CXCL12-induced breast cancer cell signaling and directional migration by a mechanism involving the CXCL12-induced generation of extracellular H2O2 and subsequent intracellular transport by AQP3 PMID: 26830227
  27. We, for the first time, identified an ERE in the promoter of AQP3 gene, and found that estrogen might promote breast cancer development through activating ERE in the promoter of AQP3 gene and upregulating AQP3 expression in ER-positive breast cancer. PMID: 26219409
  28. these findings suggest that AQP3 is required for EGF-EGFR cell signaling in cancer cells and is a therapeutic target for cancer progression. PMID: 26896765
  29. AQP3 may play a role in nonmelanoma skin cancer pathogenesis PMID: 26107428
  30. the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells. PMID: 26313002
  31. AQP3-facilitated H2O2 transport is required for NF-kappaB activation in keratinocytes in the development of psoriasis. PMID: 26100668
  32. AQP3 protein expression is regulated by cAMP-PKA-CREB signal pathway. PMID: 25961543
  33. The results suggest that morphine increases the AQP3 expression level in the colon, which promotes water absorption from the luminal side to the vascular side and causes constipation. PMID: 25766885
  34. Report down-regulation of aquaporin3 expression by lipopolysaccharide via p38/c-Jun N-terminal kinase signalling pathway in HT-29 human colon epithelial cells. PMID: 25914463
  35. AQP-3 expression is increased in the burn wound following injury. PMID: 25603981
  36. Oleic acid-induced hepatic steatosis in HepG2 cells is associated with the coordinated regulation of aquaporin 3 and aquaporin 9 via activation of p38 signaling PMID: 25105540
  37. There is a correlation between AQP3 protein expression and tumour stage and grade in urothelial cancer, with AQP3 expression being reduced or lost in tumours of higher grade and stage. PMID: 24022233
  38. AQP3 induces ERK1/2 activation, thereby increasing MMP3 expression and secretion, which in turn promotes prostate cancer cell motility and invasion. PMID: 25515250
  39. The opening of ClC-3 transports Cl(-) across the cell membrane and then drives the efflux of water through AQP-3 channels and ion channels; AQP-3 may interact with ClC-3 in order to regulate the effluxes of chloride and water. PMID: 25450461
  40. AQP3 expression in tumor tissue may be considered as a potential prognostic marker in patients with HER2-over-expressing EBC after curative surgery. PMID: 25964557
  41. results provide a mechanism by which AQP3 is upregulated, as well as highlight the importance of miR-874 in gastric cancer development and progression. PMID: 23800944
  42. Resveratrol inhibited NHEK proliferation by downregulating the expression of AQP3 in an SIRT1/ARNT/ERK dependent fashion. PMID: 24726500
  43. Investigated both AQP3 expression in the skin of an experimental burn model. Observations suggest that dermal AQP3 gene expression was increased to maintain water homeostasis in response to dehydration from burn. PMID: 24508472
  44. We conclude that water fluxes accompanying CFTR activity are linked to AQP3 but not to a cAMP-stimulated aqueous pore in the CFTR protein PMID: 24338365
  45. AQP3 promotes epithelial-mesenchymal transition in human cases of gastric adenocarcinoma. PMID: 24887009
  46. analysis of the molecular link between the circadian clock and AQP3 function in mouse dorsal skin and HaCaT cells PMID: 24418925
  47. AQP3-Notch1 axis may provide insight into epidermal homeostasis control. PMID: 24260356
  48. Our data suggest for the first time that the aberrant expression of AQP3 and AQP5 proteins may be strongly related to tumor progression and prognosis in patients with hepatocellular carcinoma PMID: 24224160
  49. AQP3-EGFP diffusion is altered upon increased cAMP, which may correspond to basolateral adaptations in response to the increased apical water readsorption. PMID: 24452376
  50. High expression of both AQP3 and AQP5, not each alone, is an independent poor prognostic factor in ESCC patients. PMID: 23797770

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Widely expressed in epithelial cells of kidney (collecting ducts) and airways, in keratinocytes, immature dendritic cells and erythrocytes. Isoform 2 is not detectable in erythrocytes at the protein level.
Database Links

HGNC: 636

OMIM: 600170

KEGG: hsa:360

STRING: 9606.ENSP00000297991

UniGene: Hs.234642

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1