Recombinant Human Interleukin-1 receptor antagonist protein(IL1RN) (Active)

In Stock
Code CSB-AP004601HU
Product Type Interleukin
Size $52Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P18510
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 7.5
Alias Interleukin-1 Receptor Antagonist Protein; IL-1RN; IL-1ra; IRAP; ICIL-1RA; IL1 Inhibitor; Anakinra; IL1RN; IL1F3; IL1RA
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by the dose-dependent inhibition of IL-1 stimulation of D10S cells is typically 0.5 ng/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Research Area Immunology
Source E.coli
Gene Names IL1RN
Expression Region 26-177aa
Tag Info Tag-Free
Mol. Weight 17.26 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
Involvement in disease Microvascular complications of diabetes 4 (MVCD4); Interleukin 1 receptor antagonist deficiency (DIRA)
Subcellular Location Isoform 1: Secreted, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm
Tissue Specificity The intracellular form of IL1RN is predominantly expressed in epithelial cells.
Database Links

HGNC: 6000

OMIM: 147679

KEGG: hsa:3557

STRING: 9606.ENSP00000259206

UniGene: Hs.81134

Related Products

IL1RN Antibodies

IL1RN Antibodies for Homo sapiens (Human)

IL1RN Antibodies for Human

IL1RN Proteins

IL1RN Proteins for Homo sapiens (Human)

IL1RN ELISA Kit

IL1RN ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.