Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha(IL15 & IL15RA) (Active)

In Stock
Code CSB-AP004671HU
Product Type Interleukin
Size $137Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q13261
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias IL15RA&IL15;Interleukin-15; IL-15; IL15;IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 20 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGD ASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Research Area Cancer
Source Mammalian cell
Gene Names IL15 & IL15RA
Expression Region 31-96aa & 49-162aa
Tag Info C-terminal FC-tagged
Mol. Weight 46.9 kDa
Protein Description Heterodimer
Still Have Questions? Leave a Message or Start an on-line Chat
Function High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.
Subcellular Location Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, Note=Mainly found associated with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 5: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 6: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 7: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 8: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein
Tissue Specificity Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15R
Database Links

HGNC: 5978

OMIM: 601070

KEGG: hsa:3601

STRING: 9606.ENSP00000369312

UniGene: Hs.445124

Pathway Jak-STAT signaling pathway

Related Products

IL15 & IL15RA Antibodies

IL15 & IL15RA Antibodies for Homo sapiens (Human)

IL15 & IL15RA Proteins

IL15 & IL15RA Proteins for Homo sapiens (Human)

IL15 & IL15RA ELISA Kit

IL15 & IL15RA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.