Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA)(N120D) Heterodimer Protein (Active)

In Stock
Code CSB-AP004671HU
Abbreviation Recombinant Human IL15&IL15RA Heterodimer protein (N120D) (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using CTLL‑2 mouse cytotoxic T cells is 5-20 ng/ml.
Target Names
IL15RA&IL15
Uniprot No.
Research Area
Cancer
Alternative Names
Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-96aa & 49-162aa(N120D)
Complete Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Mol. Weight
46.9 kDa
Protein Length
Heterodimer
Tag Info
C-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB, 8% Trehalose, 4% Mannitol, 0.02% Tween80 (w/v), pH 7.5.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

The N120D superagonist mutation in this IL-15/IL-15Rα heterodimer enhances trans-presentation signaling, making it a powerful tool for studying JAK/STAT5 pathway activation and NK/T cell biology in immuno-oncology research. Expressed in mammalian cells as a C-terminal Fc-tagged heterodimer (IL-15 aa 31–96 and IL-15Rα aa 49–162), this protein demonstrates an ED50 of 5–20 ng/mL in CTLL-2 cytotoxic T cell proliferation assays, confirming robust bioactivity suitable for cell-based functional studies including primary T cell expansion, PBMC activation, and differentiation assays. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts that can confound immune cell readouts, supporting use in sensitive in vivo tumor models and antibody development workflows such as ELISA standard curves or immunogen applications. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, provides a suitable basis for reference standard use in cytokine detection assays and NF-κB signaling studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*