Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-AP004451HU |
| Size | $4254 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml. |
| Target Names | IL20RA |
| Uniprot No. | Q9UHF4 |
| Research Area | Immunology |
| Alternative Names |
class II cytokine receptor ZCYTOR7; CRF2 8; CRF2-8; Cytokine receptor class II member 8; Cytokine receptor class-II member 8; Cytokine receptor family 2 member 8; I20RA_HUMAN; IL 20R alpha; IL 20R1; IL-20 receptor subunit alpha; IL-20R-alpha; IL-20R1; IL-20RA; IL20 Receptor alpha; IL20RA; Interleukin 20 receptor alpha chain; Interleukin 20 receptor, alpha; interleukin-20 receptor I; Interleukin-20 receptor subunit alpha; ZcytoR7
|
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 30-250aa |
| Complete Sequence | VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK |
| Mol. Weight | 26.3 kDa |
| Protein Length | Partial |
| Tag Info |
C-terminal 6xHis-tagged |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.
|
| Gene References into Functions |
|
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Type II cytokine receptor family |
| Tissue Specificity | Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin. |
| Database Links |
HGNC: 6003 OMIM: 605620 KEGG: hsa:53832 STRING: 9606.ENSP00000314976 UniGene: Hs.445868 |
