Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial (Active)

Unavailable
Code CSB-AP004451HU
MSDS
Size $154
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
class II cytokine receptor ZCYTOR7; CRF2 8; CRF2-8; Cytokine receptor class II member 8; Cytokine receptor class-II member 8; Cytokine receptor family 2 member 8; I20RA_HUMAN; IL 20R alpha; IL 20R1; IL-20 receptor subunit alpha; IL-20R-alpha; IL-20R1; IL-20RA; IL20 Receptor alpha; IL20RA; Interleukin 20 receptor alpha chain; Interleukin 20 receptor, alpha; interleukin-20 receptor I; Interleukin-20 receptor subunit alpha; ZcytoR7
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
30-250aa
Complete Sequence
VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
Mol. Weight
26.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.
Gene References into Functions
  1. the DNA fragment containing the associated SNPs interacts through chromatin looping not only with TNFAIP3, but also with IL20RA, located 680 kb upstream. PMID: 27799070
  2. IL20R1 correlated with prognosis of patients with pancreatic cancer, and mediates pancreatic cancer cell growth and migration. It may be a potential biomarker for IL24 molecular-targeted therapy. PMID: 26977011
  3. crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54% PMID: 22232181
  4. IL-20RA polymorphisms may have a role in psoriasis PMID: 19926456
  5. Complete mda-7/IL-24 receptors (IL-22R1/IL-20R2 and IL-20R1/IL-20R2) are seldom expressed in liver cancer cell lines. PMID: 19666410
  6. forms stable complex with interleukin-19 and interleukin-20 [IL-20R1][IL-20R2] PMID: 14580208
  7. sensitivity to recombinant interleukin-26(IL-26) of various cell lines strictly correlated with the expression of IL-20 1 receptor and blocking antibodies against either IL-10 receptor 2 or IL-20 receptor 1 inhibited IL-26-dependent signal transduction PMID: 15178681
  8. The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis was investigated. PMID: 18480827

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type II cytokine receptor family
Tissue Specificity
Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.
Database Links

HGNC: 6003

OMIM: 605620

KEGG: hsa:53832

STRING: 9606.ENSP00000314976

UniGene: Hs.445868

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*