Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml.

Target Names

IL20RA

Uniprot No.

Q9UHF4

Research Area

Immunology

Alternative Names

class II cytokine receptor ZCYTOR7; CRF2 8; CRF2-8; Cytokine receptor class II member 8; Cytokine receptor class-II member 8; Cytokine receptor family 2 member 8; I20RA_HUMAN; IL 20R alpha; IL 20R1; IL-20 receptor subunit alpha; IL-20R-alpha; IL-20R1; IL-20RA; IL20 Receptor alpha; IL20RA; Interleukin 20 receptor alpha chain; Interleukin 20 receptor, alpha; interleukin-20 receptor I; Interleukin-20 receptor subunit alpha; ZcytoR7

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

30-250aa

Complete Sequence

VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

Mol. Weight

26.3 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Target Background

Function

The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.

Gene References into Functions

the DNA fragment containing the associated SNPs interacts through chromatin looping not only with TNFAIP3, but also with IL20RA, located 680 kb upstream. PMID: 27799070
IL20R1 correlated with prognosis of patients with pancreatic cancer, and mediates pancreatic cancer cell growth and migration. It may be a potential biomarker for IL24 molecular-targeted therapy. PMID: 26977011
crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54% PMID: 22232181
IL-20RA polymorphisms may have a role in psoriasis PMID: 19926456
Complete mda-7/IL-24 receptors (IL-22R1/IL-20R2 and IL-20R1/IL-20R2) are seldom expressed in liver cancer cell lines. PMID: 19666410
forms stable complex with interleukin-19 and interleukin-20 [IL-20R1][IL-20R2] PMID: 14580208
sensitivity to recombinant interleukin-26(IL-26) of various cell lines strictly correlated with the expression of IL-20 1 receptor and blocking antibodies against either IL-10 receptor 2 or IL-20 receptor 1 inhibited IL-26-dependent signal transduction PMID: 15178681
The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis was investigated. PMID: 18480827

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Type II cytokine receptor family

Tissue Specificity

Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.

Database Links

HGNC: 6003

OMIM: 605620

KEGG: hsa:53832

STRING: 9606.ENSP00000314976

UniGene: Hs.445868

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-AP004451HU
MSDS	MSDS Datasheet
Size	$154
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage