Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004451HU |
| Product Type | Interleukin |
| Size |
US$104Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | Q9UHF4 |
| Lead Time | 5-10 business days |
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alias | Interleukin-20 Receptor Subunit Alpha; IL-20 Receptor Subunit Alpha; IL-20R-Alpha; IL-20RA; Cytokine Receptor Class-II Member 8; Cytokine Receptor Family 2 Member 8; CRF2-8; IL-20R1; ZcytoR7; IL20RA |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | IL20RA |
| Expression Region | 30-250aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 26.3 kDa |
| Protein Description | Partial |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26. |
| Subcellular Location | Membrane, Single-pass type I membrane protein |
| Protein Families | Type II cytokine receptor family |
| Tissue Specificity | Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin. |
| Database Links |
HGNC: 6003 OMIM: 605620 KEGG: hsa:53832 STRING: 9606.ENSP00000314976 UniGene: Hs.445868 |
| Pathway | Jak-STAT signaling pathway |
IL20RA Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA003025 | IL20RA Antibody | Human | WB,IHC,ELISA |
| CSB-PA922324 | IL20RA Antibody | Human,Mouse | ELISA,IHC |
IL20RA Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA887035ESR1HU | IL20RA Antibody | Human | ELISA, IHC |
IL20RA Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP887035HU CSB-EP887035HU CSB-BP887035HU CSB-MP887035HU |
Recombinant Human Interleukin-20 receptor subunit alpha(IL20RA),partial | Yeast E.coli Baculovirus Mammalian cell |
IL20RA ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL011631HU | Human Interleukin-20 receptor subunit alpha(IL20RA) ELISA kit | Request Information |
Recombinant Mouse Receptor-type tyrosine-protein phosphatase N2(Ptprn2),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human DNA-3-methyladenine glycosylase(MPG),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human G1/S-specific cyclin-D2(CCND2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Macaca mulatta Interleukin-15(IL15)
Express system: Yeast
Species: Macaca mulatta (Rhesus macaque)
Recombinant Human Aldehyde dehydrogenase family 1 member A3(ALDH1A3)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rabbit Tropomyosin alpha-1 chain(TPM1)
Express system: Yeast
Species: Oryctolagus cuniculus (Rabbit)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.