Recombinant Human Interleukin-20 receptor subunit alpha(IL20RA),partial

In Stock
Code CSB-AP004451HU
Product Type Interleukin
Size US$104
Uniprot No. Q9UHF4
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-20 Receptor Subunit Alpha; IL-20 Receptor Subunit Alpha; IL-20R-Alpha; IL-20RA; Cytokine Receptor Class-II Member 8; Cytokine Receptor Family 2 Member 8; CRF2-8; IL-20R1; ZcytoR7; IL20RA
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
Research Area Immunology
Source Mammalian cell
Gene Names IL20RA
Expression Region 30-250aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 26.3 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Type II cytokine receptor family
Tissue Specificity Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.
Database Links

HGNC: 6003

OMIM: 605620

KEGG: hsa:53832

STRING: 9606.ENSP00000314976

UniGene: Hs.445868

Pathway Jak-STAT signaling pathway

Related Products

IL20RA Antibodies

IL20RA Antibodies for Homo sapiens (Human)

IL20RA Antibodies for Human

IL20RA Proteins

IL20RA Proteins for Homo sapiens (Human)

IL20RA ELISA Kit

IL20RA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.