Name: Recombinant Human Carbonic anhydrase 5B, mitochondrial(CA5B) (Active)
Brand: CUSABIO
SKU: CSB-AP005641HU

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The esterase activity is determined to be greater than 1000 pmol/min/ug
Target Names	CA5B
Uniprot No.	Q9Y2D0
Research Area	Signal Transduction
Alternative Names	CA VB; CA-VB; CA5B; CAH5B_HUMAN; Carbonate dehydratase VB; Carbonic anhydrase 5B; Carbonic anhydrase 5B; mitochondrial; Carbonic anhydrase VB; Carbonic anhydrase VB; mitochondrial; mitochondrial
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	34-317aa
Complete Sequence	CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Mol. Weight	33.77 kDa
Protein Length	Full Length of Mature Protein
Tag Info	C-terminal 6xHis-tagged
Form	Liquid
Buffer	0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function (From Uniprot)	Reversible hydration of carbon dioxide.
Gene References into Functions	In 10 of 96 patients, mutations in CA5A were identified on both alleles but none in CA5B. Exhibiting decreased enzyme activity or thermal stability, all CAVA mutations were proven to cause disease, whereas the three variants showed no relevant effect PMID: 26913920 activators enhanced kcat, with no effect on KM, favoring the RDS in the catalytic cycle; the activation pattern of the two mitochondrial isoforms is very different from each other and as compared to those of the cytosolic isoforms hCA I and II. PMID: 17174092
Subcellular Location	Mitochondrion
Protein Families	Alpha-carbonic anhydrase family
Tissue Specificity	Strongest expression in heart, pancreas, kidney, placenta, lung, and skeletal muscle. Not expressed in liver.
Database Links	HGNC: 1378 OMIM: 300230 KEGG: hsa:11238 STRING: 9606.ENSP00000314099 UniGene: Hs.653287

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-AP005641HU
Size	US$3267Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Carbonic anhydrase 5B, mitochondrial(CA5B) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage