Recombinant Human Carbonic anhydrase 5B, mitochondrial(CA5B) (Active)

In Stock
Code CSB-AP005641HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The esterase activity is determined to be greater than 1000 pmol/min/ug
Target Names CA5B
Uniprot No. Q9Y2D0
Research Area Signal Transduction
Alternative Names CA VB; CA-VB; CA5B; CAH5B_HUMAN; Carbonate dehydratase VB; Carbonic anhydrase 5B; Carbonic anhydrase 5B; mitochondrial; Carbonic anhydrase VB; Carbonic anhydrase VB; mitochondrial; mitochondrial
Species Homo sapiens (Human)
Source E.coli
Expression Region 34-317aa
Complete Sequence CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Mol. Weight 33.77 kDa
Protein Length Full Length of Mature Protein
Tag Info C-terminal 6xHis-tagged
Form Liquid
Buffer 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Reversible hydration of carbon dioxide.
Gene References into Functions
  1. In 10 of 96 patients, mutations in CA5A were identified on both alleles but none in CA5B. Exhibiting decreased enzyme activity or thermal stability, all CAVA mutations were proven to cause disease, whereas the three variants showed no relevant effect PMID: 26913920
  2. activators enhanced kcat, with no effect on KM, favoring the RDS in the catalytic cycle; the activation pattern of the two mitochondrial isoforms is very different from each other and as compared to those of the cytosolic isoforms hCA I and II. PMID: 17174092
Subcellular Location Mitochondrion
Protein Families Alpha-carbonic anhydrase family
Tissue Specificity Strongest expression in heart, pancreas, kidney, placenta, lung, and skeletal muscle. Not expressed in liver.
Database Links

HGNC: 1378

OMIM: 300230

KEGG: hsa:11238

STRING: 9606.ENSP00000314099

UniGene: Hs.653287

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1