Code | CSB-AP005641HU |
Size |
InquiryPurchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The esterase activity is determined to be greater than 1000 pmol/min/ug |
Target Names | CA5B |
Uniprot No. | Q9Y2D0 |
Research Area | Signal Transduction |
Alternative Names | CA VB; CA-VB; CA5B; CAH5B_HUMAN; Carbonate dehydratase VB; Carbonic anhydrase 5B; Carbonic anhydrase 5B; mitochondrial; Carbonic anhydrase VB; Carbonic anhydrase VB; mitochondrial; mitochondrial |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 34-317aa |
Complete Sequence | CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP |
Mol. Weight | 33.77 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
C-terminal 6xHis-tagged |
Form | Liquid |
Buffer | 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Reversible hydration of carbon dioxide.
|
Gene References into Functions |
|
Subcellular Location | Mitochondrion. |
Protein Families | Alpha-carbonic anhydrase family |
Tissue Specificity | Strongest expression in heart, pancreas, kidney, placenta, lung, and skeletal muscle. Not expressed in liver. |
Database Links |
HGNC: 1378 OMIM: 300230 KEGG: hsa:11238 STRING: 9606.ENSP00000314099 UniGene: Hs.653287 |