Recombinant Human Dipeptidase 3(DPEP3), partial (Active)

In Stock
Code CSB-MP007125HU
Abbreviation Recombinant Human DPEP3 protein, partial (Active)
MSDS
Size $116
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU),the EC50 is 6.841-7.498 ng/mL. Biological Activity Assay
  • The purity of DPEP3 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU).The EC50 is 6.841-7.498 ng/mL.
Target Names
Uniprot No.
Alternative Names
UNQ834;PRO1772
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
36-463aa
Target Protein Sequence
AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS
Mol. Weight
48.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This biologically active recombinant human dipeptidase 3 (DPEP3) protein, spanning residues 36-463, is expressed in mammalian cells with a C-terminal 10×His tag. Rigorously validated for quality, it demonstrates exceptional purity (>95% by both SDS-PAGE and SEC-HPLC) and ultra-low endotoxin levels (<1.0 EU/μg, LAL method). Functional characterization via ELISA confirms specific, high-affinity binding to anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU) (EC50: 6.841–7.498 ng/mL at 2 μg/mL immobilization), affirming its structural integrity and antigenic competence. The His tag facilitates purification without disrupting functional domains, while the lyophilized form ensures stability and ease of reconstitution. This recombinant DPEP3 protein is a vital tool for studying DPEP3's roles in cancer progression, particularly in germ cell tumors and ovarian cancers, as well as its potential as a therapeutic target in antibody-drug conjugate development. Its dual purity verification makes it ideal for structural studies and high-sensitivity assays requiring minimal background interference.

The human DPEP3 protein is a metalloproteinase significant in reproductive biology, particularly in the context of male fertility. DPEP3 is primarily expressed in the testis, particularly in spermatogonia and spermatocytes, and plays a crucial role in spermatogenesis—a vital process for male fertility. This role is linked to its interaction with proteins of the ADAM (A Disintegrin and Metalloproteinase) family, indicating that DPEP3 may be essential for the maturation and functionality of sperm [1][2].

Recent studies have identified DPEP3 as part of a protein complex with TEX101, another important fertility marker. Research has shown that disrupting DPEP3 and TEX101 in germ cells and spermatocytes, especially those derived from human induced pluripotent stem cells (iPSCs), helps to elucidate their roles in producing viable sperm. However, successfully achieving in vitro spermatogenesis for humans has proven challenging, with such processes currently demonstrated only in mice [2].

Beyond its role in reproduction, DPEP3 is classified as a cancer-testis antigen (CTA), with expression noted in several cancers, including non-small cell lung cancer (NSCLC). Its presence may interact with the immune environment of tumors, and CTAs like DPEP3 could serve as potential biomarkers for malignancies, potentially leading to novel targeted therapy options in immuno-oncology [3].

References:
[1] D. Fietz, R. Sgaier, et al. Proteomic biomarkers in seminal plasma as predictors of reproductive potential in azoospermic men. Frontiers in Endocrinology, vol. 15, 2024. https://doi.org/10.3389/fendo.2024.1327800
[2] C. Schiza, D. Korbakis, E. Panteleli, K. Jarvi, A. Drabovich, & E. Diamandis. Discovery of a human testis-specific protein complex tex101-dpep3 and selection of its disrupting antibodies. Molecular & Cellular Proteomics, vol. 17, no. 12, p. 2480-2495, 2018. https://doi.org/10.1074/mcp.ra118.000749
[3] F. Hikmet, M. Rassy, et al. Expression of cancer–testis antigens in the immune microenvironment of non‐small cell lung cancer. Molecular Oncology, vol. 17, no. 12, p. 2603-2617, 2023. https://doi.org/10.1002/1878-0261.13474

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dipeptidase that hydrolyzes cystinyl-bis-glycine. Does not hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4).
Gene References into Functions
  1. This paper describes differences in substrate specificity and tissue distribution of membrane-bound dipeptidase 3 from mouse in comparison to other mouse members of this family. PMID: 12738806
Subcellular Location
Membrane; Lipid-anchor, GPI-anchor.
Protein Families
Metallo-dependent hydrolases superfamily, Peptidase M19 family
Database Links

HGNC: 23029

OMIM: 609926

KEGG: hsa:64180

STRING: 9606.ENSP00000268793

UniGene: Hs.302028

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*