Recombinant Human Dipeptidase 3(DPEP3), partial (Active)

In Stock Promotion
Code CSB-MP007125HU
Abbreviation Recombinant Human DPEP3 protein, partial (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU),the EC50 is 6.841-7.498 ng/mL. Biological Activity Assay
  • The purity of DPEP3 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU).The EC50 is 6.841-7.498 ng/mL.
Target Names
Uniprot No.
Alternative Names
UNQ834;PRO1772
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
36-463aa
Target Protein Sequence
AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS
Mol. Weight
48.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Dipeptidase 3 plays a critical role in cellular peptide metabolism and has emerged as a target of interest in cancer biology, yet functional recombinant material for mechanistic studies has been limited. This mammalian-expressed protein spanning residues 36–463 demonstrates robust binding activity in functional ELISA, with an EC50 of 6.841–7.498 ng/mL against anti-DPEP3 antibody, confirming proper folding and epitope accessibility that supports its use as a positive control in immunoassays and as a reagent for inhibitor screening campaigns. The C-terminal His tag placement preserves the N-terminal catalytic domain architecture, providing a suitable basis for enzymatic activity assays, kinetic parameter determination (Km, Vmax, kcat/Km), and substrate specificity profiling experiments. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg meet the quality thresholds commonly required for accurate kinetic measurements and structure–function studies where contaminants would confound interpretation of catalytic efficiency or inhibition mechanisms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dipeptidase that hydrolyzes cystinyl-bis-glycine. Does not hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4).
Gene References into Functions
  1. This paper describes differences in substrate specificity and tissue distribution of membrane-bound dipeptidase 3 from mouse in comparison to other mouse members of this family. PMID: 12738806
Subcellular Location
Membrane; Lipid-anchor, GPI-anchor.
Protein Families
Metallo-dependent hydrolases superfamily, Peptidase M19 family
Database Links

HGNC: 23029

OMIM: 609926

KEGG: hsa:64180

STRING: 9606.ENSP00000268793

UniGene: Hs.302028

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*