Recombinant Human Ephrin-A1 (EFNA1) (Active)

Unavailable
Code CSB-AP005711HU
Size $184
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human EphA2 in functional ELISA is less than 10 ug/ml.
Target Names
EFNA1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
B61; ECKLG; EFL 1; EFL1; EFNA 1; Efna1; EFNA1_HUMAN; EPH related receptor tyrosine kinase ligand 1; EPH-related receptor tyrosine kinase ligand 1; Ephrin-A1; Ephrin-A1, secreted form ; EphrinA1; EPLG 1; EPLG1; Immediate early response protein B61; LERK 1; LERK-1; LERK1; Ligand of eph related kinase 1; OTTHUMP00000033242; OTTHUMP00000033271; secreted form; TNF alpha-induced protein 4; TNFAIP 4; TNFAIP4; Tumor necrosis factor alpha induced protein 4 ; Tumor necrosis factor alpha-induced protein 4
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-182aa
Complete Sequence
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDPEVRVLHSIAHS
Mol. Weight
46.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*