Recombinant Human Glutathione S-transferase kappa 1 (GSTK1), partial

In Stock
Code CSB-EP009978HU
Abbreviation Recombinant Human GSTK1 protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
GSTK1
Target Names
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
EC 2.5.1.18; Glutathione S Transferase kappa 1; Glutathione S transferase subunit 13; Glutathione S-transferase k1; Glutathione S-transferase kappa 1; Glutathione S-transferase subunit 13; Glutathione S-transferase subunit 13 homolog; GST 13 13; GST 13-13; GST; GST class kappa; GST class-kappa; GST13; GST13-13; GSTK1 1; Gstk1; GSTK1-1; GSTK1_HUMAN; hGSTK1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-226aa
Target Protein Sequence
GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Mol. Weight
52.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Glutathione S-transferase kappa 1 (GSTK1) is produced in E. coli and covers the 2-226 amino acid region, representing a partial protein sequence. The product includes an N-terminal GST tag, which helps with purification and detection during experiments. SDS-PAGE analysis shows the protein reaches purity levels above 90%, making it high-quality material for research work. This product is strictly for research use and cannot be applied in diagnostic or therapeutic settings.

Glutathione S-transferase kappa 1 (GSTK1) appears to be an enzyme that participates in cellular detoxification processes. It seems to help catalyze the conjugation of glutathione to different substrates, which may aid in breaking down toxins and carcinogens. GSTK1 belongs to the larger glutathione S-transferase family - enzymes that are likely critical for cellular defense and have drawn significant research attention for their roles in drug resistance and metabolic pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Enzyme Activity and Kinetic Studies

This recombinant GSTK1 protein could help researchers characterize the enzymatic properties and substrate specificity of human glutathione S-transferase kappa 1 under controlled laboratory conditions. Scientists might perform kinetic assays with different glutathione conjugation substrates to calculate Km, Vmax, and catalytic efficiency parameters. The high purity (>90%) appears suitable for detailed biochemical studies. However, the N-terminal GST tag may need careful consideration during experimental design, since it could potentially affect enzymatic activity measurements.

2. Protein-Protein Interaction Studies

The recombinant GSTK1 could work as bait or target protein in pull-down assays to find new protein interaction partners or confirm existing ones. Its N-terminal GST tag makes immobilization on glutathione-sepharose beads straightforward for affinity purification experiments. This strategy might help clarify cellular pathways that involve GSTK1 and broaden our understanding of its biological roles beyond glutathione conjugation. Scientists could also perform co-immunoprecipitation studies with cell lysates to examine endogenous protein complexes.

3. Antibody Development and Validation

This purified recombinant protein works well as an antigen for creating specific antibodies against human GSTK1 through standard immunization protocols. The high purity should minimize cross-reactivity with other proteins during antibody production. Researchers can then validate these antibodies using the same recombinant protein in ELISA, Western blot, and similar immunoassays. The defined protein sequence (amino acids 2-226) offers a well-characterized target for epitope mapping experiments.

4. Structural and Biophysical Analysis

Scientists might use the recombinant GSTK1 protein in structural biology studies - X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy could reveal its three-dimensional structure. Biophysical techniques like dynamic light scattering, circular dichroism spectroscopy, and thermal stability assays may provide insights into protein folding and stability. The high purity level seems appropriate for these sensitive analytical methods that demand well-defined protein samples.

5. Inhibitor Screening and Drug Discovery Research

This recombinant protein could be valuable in high-throughput screening assays designed to identify small molecule inhibitors or modulators of GSTK1 activity. Researchers might test compound libraries through enzymatic assays to discover potential research tools or lead compounds. The purified protein allows for dose-response studies to determine IC50 values and structure-activity relationships of promising hits. Such screening work may contribute to understanding GSTK1 function and developing research reagents for additional biological studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
Gene References into Functions
  1. Several biological properties of the GST-hNdCTR1 fusion protein were assessed. It was demonstrated that in cells, the protein was prone to oligomerization, formed inclusion bodies and displayed no toxicity. Treatment of E. coli cells with copper and silver ions reduced cell viability in a dose- and time-dependent manner PMID: 29099786
  2. we confirmed several existing chemoinformatic filters and more importantly extended them as well as added novel filters that specify compounds with anti-GST/GSH activity. Selected compounds were also tested using different antibody-based GST detection technologies and exhibited no interference clearly demonstrating specificity toward their GST/GSH interaction. PMID: 27044684
  3. Our findings indicate that the medical staff exposed to low IR levels were under risk of significant oxidative stress that was enhanced by their glutathione S-transferase (GST) polymorphisms. PMID: 28287017
  4. GSTK1 T/T genotype may be a novel risk factor for the prediction of overweight status in SCZ male patients. PMID: 27010189
  5. High glutathione-S-transferase is associated with type 2 diabetes mellitus. PMID: 27377684
  6. DsbA-L is localized in both the mitochondria and the endoplasmic reticulum (ER) in adipocytes; its ER localization plays a critical role in suppressing ER stress and promoting adiponectin biosynthesis and secretion. PMID: 25739441
  7. we have optimized the GST-Nck1-SH2 pull-down procedure to obtain tyrosine-phosphorylated proteins in tumor tissues PMID: 23426619
  8. drug resistance in three strains of tumor cells is associated with significant increase in hGSTP1 and hGSTA4 gene expression, whereas increased hGSTK1 gene expression was detected only in resistant erythroleukemia and mammary adenocarcinoma cells. PMID: 23330092
  9. This study does not give evidence of interaction between the GST polymorphisms and smoking may although this study provided sufficient statistical power to detect modest interaction. PMID: 20472488
  10. SNP-1308G/T (rs1917760) genotypes of DsbA-L gene might participate in insulin secretion and body fat distribution. It is possible that polymorphisms of DsbA-L gene associated with metabolic diseases[DsbA-L] PMID: 19225211
  11. structure and function characterization of a GST from human breast PMID: 14709161
  12. Gene and protein characterization; its subcellular localization in peroxisomes, suggesting a new function for this family of enzymes [glutathione S-transferase kappa (hGSTK1)] PMID: 14742434
  13. crystal structure of hGSTK1 has been determined by the multiple-isomorphous replacement method and refined to 1.93 A resolution PMID: 16081649
  14. Our results suggest that genetic polymorphisms of xenobiotic-metabolizing enzymes could play an important role in infertility. PMID: 18774560
  15. The objective of this study was to investigate the molecular mechanisms underlying Group B Streptococcus-human umbilical vein endothelial cells interaction, focusing specifically on the responsiveness of host protein tyrosine kinase (PTK). PMID: 19639233
  16. Observational study of gene-disease association. (HuGE Navigator) PMID: 19225211
  17. Observational study of gene-disease association. (HuGE Navigator) PMID: 17601350
  18. Presence of hGSTK1 in both peroxisomes and mitochondria. The C-terminus of hGSTK1 is essential for localization of the protein to peroxisomes, and the C-terminal sequence Ala-Arg-Leu represents a peroxisome targeting signal 1 (PTS1). PMID: 14742434

Show More

Hide All

Subcellular Location
Peroxisome.
Protein Families
GST superfamily, Kappa family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 16906

OMIM: 602321

KEGG: hsa:373156

UniGene: Hs.390667

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*