Recombinant Human Glutathione S-transferase kappa 1(GSTK1) (Active)

Code CSB-EP009978HU
Product Type Other
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q9Y2Q3
Relevance Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 μg/ml can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng/ml.
Storage Buffer Tris-based buffer,50% glycerol
Alias GST 13-13 GST class-kappa GSTK1-1
Species Homo sapiens (Human)
Biological_Activity Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 μg/ml can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin GSTK1
Sequence GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Research Area Tags & Cell Markers
Source E.coli
Gene Names GSTK1
Expression Region 2-226aa
Tag Info N-terminal GST-tagged
Mol. Weight 52.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
Subcellular Location Peroxisome
Protein Families GST superfamily, Kappa family
Tissue Specificity Ubiquitous.
Database Links

HGNC: 16906

OMIM: 602321

KEGG: hsa:373156

UniGene: Hs.390667

Related Products

GSTK1 Antibodies

GSTK1 Antibodies for Homo sapiens (Human)

GSTK1 Antibodies for Human

GSTK1 Proteins

GSTK1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.