Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS (CSB-MP707478HU), the EC₅₀ of human ICOSLG protein is 29.04-43.59 ng/ml.

Target Names

ICOSLG

Uniprot No.

O75144

Research Area

Cancer

Alternative Names

ICOSLG; B7H2; B7RP1; ICOSL; KIAA0653; ICOS ligand; B7 homolog 2; B7-H2; B7-like protein Gl50; B7-related protein 1; B7RP-1; CD antigen CD275

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-258aa

Target Protein Sequence

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS

Mol. Weight

28.9 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Human ICOS ligand (ICOSLG) amino acid Asp19-Ser258, with an N-terminal linker, and a C-terminal 6xHis-tag, was expressed in mammalian cells. The product is the recombinant human ICOSLG protein. It is an active protein whose bioactivity has been measured by its binding ability with the human ICOS receptor in a functional ELISA. The EC₅₀ of human ICOSLG protein is 29.04-43.59 ng/ml. The purity of this ICOSLG protein reaches up to 95% determined by SDS-PAGE. It has an apparent molecular mass of 40 kDa on SDS-PAGE while its predicted mass is 28.9 kDa. Glycosylation causes this result. Its endotoxin level is less than 1.0 EU/ug measured by the LAL method. And it is in stock now.

ICOSLG is the ligand for inducible costimulatory molecule (ICOS). ICOS-ICOSLG interaction delivers the co-stimulatory signals that facilitate the activation and differential of T cells. Dysregulation of the ICOS-ICOSLG pathway has been associated with autoimmune diseases and cancer and is a potential immune checkpoint blockade.

Target Background

Function

Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Immunoglobulin superfamily, BTN/MOG family

Tissue Specificity

Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leuko

Database Links

HGNC: 17087

OMIM: 605717

KEGG: hsa:102723996

STRING: 9606.ENSP00000384432

UniGene: Hs.14155

Code	CSB-MP010958HU1
Abbreviation	Recombinant Human ICOSLG protein, partial (Active)
MSDS	MSDS Datasheet
Size	$194
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS (CSB-MP707478HU), the EC₅₀ of human ICOSLG protein is 29.04-43.59 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human ICOS ligand (ICOSLG), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage