Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-MP010958HU1 |
| Size | $428 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
Human ICOS ligand (ICOSLG) amino acid Asp19-Ser258, with an N-terminal linker, and a C-terminal 6xHis-tag, was expressed in mammalian cells. The product is the recombinant human ICOSLG protein. It is an active protein whose bioactivity has been measured by its binding ability with the human ICOS receptor in a functional ELISA. The EC50 of human ICOSLG protein is 29.04-43.59 ng/ml. The purity of this ICOSLG protein reaches up to 95% determined by SDS-PAGE. It has an apparent molecular mass of 40 kDa on SDS-PAGE while its predicted mass is 28.9 kDa. Glycosylation causes this result. Its endotoxin level is less than 1.0 EU/ug measured by the LAL method. And it is in stock now. ICOSLG is the ligand for inducible costimulatory molecule (ICOS). ICOS-ICOSLG interaction delivers the co-stimulatory signals that facilitate the activation and differential of T cells. Dysregulation of the ICOS-ICOSLG pathway has been associated with autoimmune diseases and cancer and is a potential immune checkpoint blockade. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS (CSB-MP707478HU), the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml. |
| Target Names | ICOSLG |
| Uniprot No. | O75144 |
| Research Area | Cancer |
| Alternative Names |
ICOSLG; B7H2; B7RP1; ICOSL; KIAA0653; ICOS ligand; B7 homolog 2; B7-H2; B7-like protein Gl50; B7-related protein 1; B7RP-1; CD antigen CD275
|
| Molecular Characterization |  |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 19-258aa |
| Target Protein Sequence | DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS |
| Mol. Weight | 28.9 kDa |
| Protein Length | Partial |
| Tag Info |
C-terminal 6xHis-tagged |
| Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function.
|
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Protein Families | Immunoglobulin superfamily, BTN/MOG family |
| Tissue Specificity | Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leuko |
| Database Links |
HGNC: 17087 OMIM: 605717 KEGG: hsa:102723996 STRING: 9606.ENSP00000384432 UniGene: Hs.14155 |
