Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-AP005431HU |
Size |
InquiryPurchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 20 ug/ml. |
Target Names | INHBC |
Uniprot No. | P55103 |
Research Area | Signal Transduction |
Alternative Names | Activin beta C chain; Activin beta-C chain; IHBC; Inhbc; INHBC_HUMAN; Inhibin beta C chain; Inhibin, beta C |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 237-352aa |
Complete Sequence | GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS |
Mol. Weight | 14.83 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-tagged |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm Filtered 4 mM HCl, 1 mM DTT |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
|
Gene References into Functions |
|
Subcellular Location | Secreted. |
Protein Families | TGF-beta family |
Tissue Specificity | Expressed in benign prostatic hyperplasia. |
Database Links |
HGNC: 6068 OMIM: 601233 KEGG: hsa:3626 STRING: 9606.ENSP00000308716 UniGene: Hs.632722 |