Name: Recombinant Human Inhibin beta C chain(INHBC) (Active)
Brand: CUSABIO
SKU: CSB-AP005431HU

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 20 ug/ml.
Target Names	INHBC
Uniprot No.	P55103
Research Area	Signal Transduction
Alternative Names	Activin beta C chain; Activin beta-C chain; IHBC; Inhbc; INHBC_HUMAN; Inhibin beta C chain; Inhibin, beta C
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	237-352aa
Complete Sequence	GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
Mol. Weight	14.83 kDa
Protein Length	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm Filtered 4 mM HCl, 1 mM DTT
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Gene References into Functions	Study shows an up-regulation of activin-C in aggressive prostate cancer only, suggesting that activin-C may play a role in the advanced stages of the disease. PMID: 28116672 The inhibin-betaC subunit is down-regulated, while inhibin-betaE is up-regulated by interferon-beta1a in Ishikawa carcinoma cell line. PMID: 23580013 Single Nucleotide Polymorphisms in INHBC gene is associated with brain metastasis in non-small-cell lung cancer PMID: 23284751 Activin-beta(C) is a regulator of activin-A. Activin-beta(C) is able to abolish cachexia and modulate reproductive tumour development in inhibin alpha-subunit knockout mice (alpha-KO) mice. PMID: 23180294 inhibin-betaC in normal and pathological placental tissue was demonstrated, although no differences in staining intensity could be observed. Functional role of novel inhibin-betaC subunit in normal and pathological human placenta is still quite unclear. PMID: 21117833 in endometrial cancer tissue demonstrated a significant association with hemangiosis although without any impact on the patients' survival PMID: 20683603 differential expression pattern of the betaC- and betaE-subunits in normal human endometrial tissue suggests that they function in endometrial maturation and blastocyst implantation. PMID: 21092084 the novel inhibin/activin-betaC subunit is expressed in human endometrioid adenocarcinomas and in the human endometrial carcinoma cell line HEC-1a PMID: 20952735 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20884846 Expression of the inhibin betaC and betaE subunits was demonstrated at the protein level and at the transcriptional level in normal human endometrial tissue and in the Ishikawa human endometrial carcinoma cell line. PMID: 20012305 Expression of inhibin beta C was detected in the human chorionic carcinoma cell lines JEG and BeWoand also in human placenta. PMID: 20458061 Role for the activin betaC-subunit as a regulatory mechanism to reduce activin A secretion via intracellular heterodimerization. PMID: 12960042 activin betaC subunit may exert its effect as inhibin C PMID: 16627954 Show More Hide All
Subcellular Location	Secreted.
Protein Families	TGF-beta family
Tissue Specificity	Expressed in benign prostatic hyperplasia.
Database Links	HGNC: 6068 OMIM: 601233 KEGG: hsa:3626 STRING: 9606.ENSP00000308716 UniGene: Hs.632722

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-AP005431HU
Size	InquiryPurchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Inhibin beta C chain(INHBC) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage