Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 20 ug/ml.

Target Names

INHBC

Uniprot No.

P55103

Research Area

Signal Transduction

Alternative Names

Activin beta C chain; Activin beta-C chain; IHBC; Inhbc; INHBC_HUMAN; Inhibin beta C chain; Inhibin, beta C

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

237-352aa

Complete Sequence

GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Mol. Weight

14.83 kDa

Protein Length

partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm Filtered 4 mM HCl, 1 mM DTT

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Gene References into Functions

Study shows an up-regulation of activin-C in aggressive prostate cancer only, suggesting that activin-C may play a role in the advanced stages of the disease. PMID: 28116672
The inhibin-betaC subunit is down-regulated, while inhibin-betaE is up-regulated by interferon-beta1a in Ishikawa carcinoma cell line. PMID: 23580013
Single Nucleotide Polymorphisms in INHBC gene is associated with brain metastasis in non-small-cell lung cancer PMID: 23284751
Activin-beta(C) is a regulator of activin-A. Activin-beta(C) is able to abolish cachexia and modulate reproductive tumour development in inhibin alpha-subunit knockout mice (alpha-KO) mice. PMID: 23180294
inhibin-betaC in normal and pathological placental tissue was demonstrated, although no differences in staining intensity could be observed. Functional role of novel inhibin-betaC subunit in normal and pathological human placenta is still quite unclear. PMID: 21117833
in endometrial cancer tissue demonstrated a significant association with hemangiosis although without any impact on the patients' survival PMID: 20683603
differential expression pattern of the betaC- and betaE-subunits in normal human endometrial tissue suggests that they function in endometrial maturation and blastocyst implantation. PMID: 21092084
the novel inhibin/activin-betaC subunit is expressed in human endometrioid adenocarcinomas and in the human endometrial carcinoma cell line HEC-1a PMID: 20952735
Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20884846
Expression of the inhibin betaC and betaE subunits was demonstrated at the protein level and at the transcriptional level in normal human endometrial tissue and in the Ishikawa human endometrial carcinoma cell line. PMID: 20012305
Expression of inhibin beta C was detected in the human chorionic carcinoma cell lines JEG and BeWoand also in human placenta. PMID: 20458061
Role for the activin betaC-subunit as a regulatory mechanism to reduce activin A secretion via intracellular heterodimerization. PMID: 12960042
activin betaC subunit may exert its effect as inhibin C PMID: 16627954

Hide All

Subcellular Location

Secreted.

Protein Families

TGF-beta family

Tissue Specificity

Expressed in benign prostatic hyperplasia.

Database Links

HGNC: 6068

OMIM: 601233

KEGG: hsa:3626

STRING: 9606.ENSP00000308716

UniGene: Hs.632722

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-AP005431HU
MSDS	MSDS
Size	$290
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Inhibin beta C chain (INHBC), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage