Home
Active Protein
Other
Recombinant Human Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)

Recombinant Human Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)

^{In Stock}

Code	CSB-MP756966HU
Abbreviation	Recombinant Human ITPRIPL1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/ml can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC₅₀ is 6.537-7.663 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 6.537-7.663 ng/mL.

Target Names

ITPRIPL1

Uniprot No.

Q6GPH6

Alternative Names

ITPRIPL1; KIAA1754L; Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

25-103aa

Target Protein Sequence

HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG

Mol. Weight

10.7 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

ITPRIPL1 participates in inositol trisphosphate receptor signaling pathways, yet functional reagents covering defined interaction domains remain limited for mechanistic studies. This mammalian-expressed fragment spanning residues 25–103 demonstrates quantifiable antibody-binding activity with an EC50 of 6.537–7.663 ng/mL in functional ELISA, providing a validated tool for epitope mapping studies and antibody specificity profiling against this receptor-interacting protein. The C-terminal 10xHis tag enables straightforward immobilization for surface plasmon resonance experiments and protein-protein interaction screens aimed at identifying novel ITPRIPL1 binding partners. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this preparation meets the quality thresholds commonly required for immunoassay development and supports use as a positive control in binding assays where reproducible antibody recognition is essential.