Recombinant Human Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)

In Stock
Code CSB-MP756966HU
Abbreviation Recombinant Human ITPRIPL1 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 6.537-7.663 ng/mL.
Target Names
Uniprot No.
Alternative Names
ITPRIPL1; KIAA1754L; Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
25-103aa
Target Protein Sequence
HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
Mol. Weight
10.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human ITPRIPL1 protein is an active form expressed in a mammalian system to maintain native folding and post-translational modifications essential for functionality. It consists of amino acids 25 to 103, representing the extracellular region of the human ITPRIPL1 protein, and is fused with a C-terminal 10xHis tag for ease of purification and detection. Supplied as a lyophilized powder, this recombinant ITPRIPL1 protein meets high-quality standards, with purity greater than 95% as confirmed by SDS-PAGE and endotoxin levels kept below 1.0 EU/µg, verified by the LAL assay. Functional ELISA results show that when immobilized at 2 μg/mL, ITPRIPL1 binds specifically to the anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU), with an EC50 ranging from 6.537 to 7.663 ng/mL. This makes it a reliable reagent for antibody validation, molecular interaction studies, and functional assays involving ITPRIPL1.

The human ITPRIPL1 protein has garnered attention for its functional roles in various biological contexts, particularly within immunology and oncology. ITPRIPL1 is a single-pass transmembrane protein that interacts with inositol trisphosphate receptors and influences intracellular calcium signaling pathways integral to numerous cellular processes such as proliferation, differentiation, and apoptosis [1].

Recent research has highlighted the implications of ITPRIPL1 in cancer biology. Specifically, ITPRIPL1 has been characterized as a potential immunological biomarker and prognostic factor in various cancers, including non-small cell lung cancer [1][2]. The expression levels of ITPRIPL1 in the tumor microenvironment are often correlated with the activity of CD8+ T cells. Lower levels of ITPRIPL1 have been associated with increased T cell infiltration, which is critical for effective anti-tumor responses [1]. The reduction of T cell activity linked to ITPRIPL1 expression suggests that this protein may serve as a modulator of immune evasion in tumors, promoting tumor growth through immune suppression mechanisms [1].

It has been suggested that variations in ITPRIPL1 expression impact signaling pathways, particularly the PI3K pathway, which is important in cancer progression and cell survival [1]. The interplay between ITPRIPL1 and these growth factor signaling pathways indicates the protein's participation in regulating cellular homeostasis and response to external signals.

Furthermore, ITPRIPL1 interacts with other proteins that mediate signaling pathways related to cancer progression, including its potential co-existence with proteins such as ANKRD36, which highlights its involvement in complex biological networks associated with tumorigenesis and disease progression [3]. The overall evidence points to ITPRIPL1 acting as an intracellular signaling mediator and a pivotal actor in the immune landscape of tumors, proposing a multifaceted role in cancer biology that warrants further exploration.

References:
[1] W. Duan, W. Tian, Z. Li, Y. Liu, & L. Xu. A comprehensive pan-cancer analysis revealing the role of itpripl1 as a prognostic and immunological biomarker. Frontiers in Molecular Biosciences, vol. 11, 2024. https://doi.org/10.3389/fmolb.2024.1452290
[2] S. Deng, J. Shi, et al. Development of a monoclonal antibody to itpripl1 for immunohistochemical diagnosis of non-small cell lung cancers: accuracy and correlation with cd8+ t cell infiltration. Frontiers in Cell and Developmental Biology, vol. 11, 2023. https://doi.org/10.3389/fcell.2023.1297211
[3] Z. Iqbal, M. Absar, et al. Integrated genomic analysis identifies ankrd36 gene as a novel and common biomarker of disease progression in chronic myeloid leukemia. 2021. https://doi.org/10.20944/preprints202108.0498.v1

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
ITPRIP family
Database Links

HGNC: 29371

KEGG: hsa:150771

STRING: 9606.ENSP00000355121

UniGene: Hs.65009

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*