Recombinant Human Interleukin-1 receptor accessory protein-like 1 (IL1RAPL1), partial (Active)

In Stock
Code CSB-MP011624HU1
Abbreviation Recombinant Human IL1RAPL1 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human PTPRD protein (CSB-MP019051HU(A4)) at 2 μg/ml can bind Human IL1RAPL1 protein. The EC50 is 2.645-3.098 ng/mL. Biological Activity Assay
  • The purity of IL1RAPL1 was greater than 95% as determined by SEC-HPLC
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human PTPRD protein (CSB-MP019051HU(A4)) at 2 μg/mL can bind Human IL1RAPL1 protein. The EC50 is 2.645-3.098 ng/mL.
Target Names
Uniprot No.
Alternative Names
Interleukin-1 receptor accessory protein-like 1; EC:3.2.2.6; IL-1-RAPL-1; IL-1RAPL-1;  IL1RAPL-1;Oligophrenin-4; Three immunoglobulin domain-containing IL-1 receptor-related 2 (TIGIRR-2); X-linked interleukin-1 receptor accessory protein-like 1; IL1RAPL1; OPHN4
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-357aa
Target Protein Sequence
LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT
Mol. Weight
66.4 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May regulate secretion and presynaptic differentiation through inhibition of the activity of N-type voltage-gated calcium channel. May activate the MAP kinase JNK. Plays a role in neurite outgrowth. During dendritic spine formation can bidirectionally induce pre- and post-synaptic differentiation of neurons by trans-synaptically binding to PTPRD.
Gene References into Functions
  1. Our study revealed that the expression of IL-1R8 significantly increased on in vitro-activated CD4+ T cells and was markedly higher on CD4+ T cells from allergic rhinitis patients than on cells from healthy controls. PMID: 29730558
  2. IL-1R8 serves as a checkpoint for NK cell maturation and effector function; its genetic blockade unleashes NK-cell-mediated resistance to hepatic carcinogenesis, haematogenous liver and lung metastasis, and cytomegalovirus infection in mice PMID: 29072292
  3. Altered DNA methylation in IL1RAPL1 involves in the etiology of Bipolar disorder and Major Depressive disorder . PMID: 27440233
  4. rs12007907 variant in IL1RAPL gene was negatively associated with asthma and IL-13 production in Latin American children. PMID: 28120837
  5. Our study expands the molecular repertoire of IL1RAPL1 mutations in intellectual disability and points out the need of more accurate clinical descriptions to better define the related phenotype PMID: 27470653
  6. It was indicated that a defect in IL1RAPL1 that controls excitatory synapsis formation results in the excitation-inhibition balance affecting various cerebral functions. PMID: 25864829
  7. Novel IL1RAPL1 mutations associated with intellectual disability impair synaptogenesis. PMID: 25305082
  8. The interaction of the IL1RAPL1 family of proteins with PTPdelta and RhoGAP2 reveals a pathophysiological mechanism of cognitive impairment associated with a novel type of trans-synaptic signaling. PMID: 21926414
  9. The IL1RAPL1 gene is of interest as a candidate gene for autism spectrum disorder as mutations or deletions in the gene have previously been reported in individuals from families with ASD. PMID: 21491612
  10. Intragenic deletions in IL1RAPL1are relevant to the pathogenesis of X-linked mental retardation. PMID: 21271657
  11. crystal structure at 2.3-A resolution of the TIR domain of IL-1RAPL PMID: 15123616
  12. Nearly all patients with deletions involving DAX1, but not DMD, had mental retardation if IL1RAPL1 was deleted. If ILIRAPLI & DMD were intact, the patients with DAX1 deletions only rarely had normal development. PMID: 15300857
  13. Report confirms the role of the IL1RAPL1 gene in causing nonspecific mental retardation in males. PMID: 16470793
  14. DMD gene and its immediately distal neighbor, the 1.8 Mb IL1RAPL1 gene are abundantly expressed in normal brain but were dramatically underexpressed in every brain tumor cell line and xenograft. PMID: 18253029
  15. Combined data suggested that IL1RAPL1 affected human cognitive ability to some extent, especially the memory and concentration capability. PMID: 18467032
  16. The function of truncated IL1RAPL1 protein in an autistic female with Asperger syndrome is severely altered in hippocampal neurons, demonstrated by its effect on neurite outgrowth activity. PMID: 18801879
  17. IL1RAPL1 plays an important role in the etiology of X-linked mental retardation. PMID: 19012350

Show More

Hide All

Involvement in disease
Mental retardation, X-linked 21 (MRX21)
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Cell projection, axon. Cell projection, dendrite.
Protein Families
Interleukin-1 receptor family
Tissue Specificity
Detected at low levels in heart, skeletal muscle, ovary, skin, amygdala, caudate nucleus, corpus callosum, hippocampus, substantia nigra and thalamus. Detected at very low levels in tonsil, prostate, testis, small intestine, placenta, colon and fetal live
Database Links

HGNC: 5996

OMIM: 300143

KEGG: hsa:11141

STRING: 9606.ENSP00000305200

UniGene: Hs.658912

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*